Germany
Japan
United Kingdom
China
qSTAR qPCR primer pairs against Homo sapiens gene AHR
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Products
View as table DownloadAhr - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
Goat Anti-AHR Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PENQKHGLNPQSA, from the internal region of the protein sequence according to NP_001612.1. |
Goat Anti-Aryl Hydrocarbon Receptor (aa749-763) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KHGLNPQSAIITPQT, from the internal region of the protein sequence according to NP_001612.1. |
Rabbit Polyclonal anti-AHR antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AHR antibody: synthetic peptide directed towards the N terminal of human AHR. Synthetic peptide located within the following region: MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRL |
Ahr - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
AHR CRISPRa kit - CRISPR gene activation of human aryl hydrocarbon receptor
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ahr CRISPRa kit - CRISPR gene activation of mouse aryl-hydrocarbon receptor
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene AHR
| Application | Plasmid of exact quantity for transcript copy number calculation |
Ahr - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 mBFP-Neo donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
Ahr - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 Luciferase-Puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
Ahr - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 RFP-BSD donor, 1 scramble control |
| Donor DNA | RFP-BSD |
Aryl Hydrocarbon Receptor Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human AhR |
USD 380.00
4 Weeks
AhR (phospho-S36) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide derived from human AhR around the phosphorylation site of Serine 36. |
Transient overexpression of AHR (NM_001621) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Ahr - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Ahr - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Ahr - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Ahr - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of AHR (NM_001621) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AHR (NM_001621) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- AHR