Germany
Japan
United Kingdom
China
Lenti ORF clone of Atf3 (mGFP-tagged) - Mouse activating transcription factor 3 (Atf3)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Products
View as table Download
Lenti ORF clone of Human activating transcription factor 3 (ATF3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human activating transcription factor 3 (ATF3), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Lenti ORF clone of Human activating transcription factor 3 (ATF3), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human activating transcription factor 3 (ATF3), transcript variant 4, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Atf3 (Myc-DDK-tagged) - Mouse activating transcription factor 3 (Atf3)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human activating transcription factor 3 (ATF3), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human activating transcription factor 3 (ATF3), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of activating transcription factor 3 (ATF3), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit polyclonal anti-ATF3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATF3. |
qSTAR qPCR primer pairs against Homo sapiens gene ATF3
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Transient overexpression lysate of activating transcription factor 3 (ATF3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
ATF3 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
ATF3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ATF3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Monoclonal antibody against ATF-3 (ATF3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
qSTAR qPCR primer pairs against Mus musculus gene Atf3
Lenti ORF clone of Atf3 (Myc-DDK-tagged) - Mouse activating transcription factor 3 (Atf3)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human activating transcription factor 3 (ATF3), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human activating transcription factor 3 (ATF3), transcript variant 4, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human activating transcription factor 3 (ATF3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
ATF3 (untagged)-Human activating transcription factor 3 (ATF3), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ATF3 (untagged)-Human activating transcription factor 3 (ATF3), transcript variant 3
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Atf3 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Atf3 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
ATF3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Atf3 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Human activating transcription factor 3 (ATF3), transcript variant 3, full length, with N-terminal GST tag and C-terminal HIS tag, expressed in sf9, 20ug
| Tag | N-GST and C-His |
| Expression Host | Sf9 |
Purified recombinant protein of Human activating transcription factor 3 (ATF3), transcript variant 3, full length, N-terminal GST tag, expressed in E. coli, 50ug
| Tag | N-GST |
| Expression Host | E. coli |
ATF3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 139-168 amino acids from the C-terminal region of human ATF3 |
ATF3 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
qPCR primer pairs and template standards against Mus musculus gene Atf3
| Application | Plasmid of exact quantity for transcript copy number calculation |
Rabbit Polyclonal anti-Atf3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Atf3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Atf3. Synthetic peptide located within the following region: ESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFI |
Rabbit Polyclonal Anti-ATF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF3 antibody: synthetic peptide directed towards the middle region of human ATF3. Synthetic peptide located within the following region: PLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK |
ATF3 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Atf3 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
ATF3 (1-181) human recombinant protein, 0.5 mg
| Expression Host | E. coli |
ATF3 (1-181) human recombinant protein, 0.1 mg
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) ATF3 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ATF3 CRISPRa kit - CRISPR gene activation of human activating transcription factor 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Atf3 CRISPRa kit - CRISPR gene activation of mouse activating transcription factor 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ATF3
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene ATF3
| Application | Plasmid of exact quantity for transcript copy number calculation |
ATF3 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
ATF3 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
ATF3 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
ATF3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Active filters
Target Symbol
- ATF3
Filter by
Species
Reactivities
Antibody Hosts
Clonalities
Conjugates
Expression Hosts
Lentivirus
Tags
Vectors
- pLenti-C-Myc-DDK-P2A-Puro (12)
- pLenti-C-mGFP-P2A-Puro (12)
- pCMV6-Entry (11)
- pCMV6-AC-GFP (8)
- pLenti-C-Myc-DDK (8)
- pLenti-C-mGFP (8)
- pGFP-C-shLenti (6)
- pRS (3)
- EF1a-GFP-P2A-Puro (2)
- GFP-puro (1)
- Luciferase-Puro (1)
- PCMV6-Kan/Neo (1)
- RFP-BSD (1)
- mBFP-Neo (1)
- pCMV6-AC (1)
- pCMV6-XL4 (1)
- pCMV6-XL5 (1)
- pRFP-C-RS (1)