Germany
Japan
United Kingdom
China
Products
View as table Download
Dlk1 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Rabbit polyclonal anti-DLK1 antibody (CT)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | DLK1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human DLK1. |
Rabbit Polyclonal Anti-DLK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLK1 antibody: synthetic peptide directed towards the middle region of human DLK1. Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT |
DLK1 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Dlk1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Dlk1 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
DLK1 (24-303, His-tag) human protein, 0.25 mg
| Tag | His-tag |
| Expression Host | Insect |
DLK1 (24-303, His-tag) human protein, 50 µg
| Tag | His-tag |
| Expression Host | Insect |
DLK1 CRISPRa kit - CRISPR gene activation of human delta like non-canonical Notch ligand 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Dlk1 CRISPRa kit - CRISPR gene activation of mouse delta like non-canonical Notch ligand 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene DLK1
| Application | Plasmid of exact quantity for transcript copy number calculation |
Dlk1 (untagged) - Mouse delta-like 1 homolog (Drosophila) (Dlk1), transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Dlk1 (untagged) - Mouse delta-like 1 homolog (Drosophila) (Dlk1), transcript variant 2, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Dlk1 (untagged) - Mouse delta-like 1 homolog (Drosophila) (Dlk1), transcript variant 3, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Dlk1 (untagged) - Mouse delta-like 1 homolog (Drosophila) (Dlk1), transcript variant 4, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Dlk1
DLK1 MS Standard C13 and N15-labeled recombinant protein (NP_003827)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Dlk1 (untagged ORF) - Rat delta-like 1 homolog (Drosophila) (Dlk1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of delta-like 1 homolog (Drosophila) (DLK1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Dlk1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
DLK1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DLK1 |
DLK1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 83-383 of human DLK1 (NP_003827.3). |
| Modifications | Unmodified |
Transient overexpression of DLK1 (NM_003836) in HEK293T cells paraffin embedded controls for ICC/IHC staining
DLK1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
DLK1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Dlk1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Dlk1 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse delta like non-canonical Notch ligand 1 (Dlk1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
Recombinant protein of human delta-like 1 homolog (Drosophila) (DLK1)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human delta-like 1 homolog (Drosophila) (DLK1)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human delta-like 1 homolog (Drosophila) (DLK1)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human delta-like 1 homolog (Drosophila) (DLK1)
| Tag | C-His |
| Expression Host | HEK293 |
DLK1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Dlk1 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of DLK1 (NM_003836) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DLK1 (NM_003836) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- DLK1