LOC102163346 rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Biotin |
| Immunogen | Malic dehydrogenase is isolated and purified from Porcine heart. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
LOC102163346 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Immunogen | Malic dehydrogenase is isolated and purified from Porcine heart. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
MDH1 (1-334, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
MDH1 (1-334, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-Mdh1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Mdh1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mdh1. Synthetic peptide located within the following region: YSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIAT |
Rabbit Polyclonal Anti-MDH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MDH1 antibody: synthetic peptide directed towards the middle region of human MDH1. Synthetic peptide located within the following region: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV |
Transient overexpression lysate of malate dehydrogenase 1, NAD (soluble) (MDH1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Mdh1 (untagged) - Mouse malate dehydrogenase 1, NAD (soluble) (cDNA clone MGC:61422 IMAGE:6820601), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
Lenti-ORF clone of MDH1 (Myc-DDK-tagged)-Human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 3
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
MDH1 (untagged)-Human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 2
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MDH1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
MDH1 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human MDH1 |
MDH1 CRISPRa kit - CRISPR gene activation of human malate dehydrogenase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Mdh1 CRISPRa kit - CRISPR gene activation of mouse malate dehydrogenase 1, NAD (soluble)
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene MDH1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene MDH1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
MDH1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
MDH1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Mdh1
MDH1 MS Standard C13 and N15-labeled recombinant protein (NP_005908)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Mdh1 (untagged ORF) - Rat malate dehydrogenase 1, NAD (soluble) (Mdh1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of malate dehydrogenase 1 NAD (soluble) (MDH1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Mdh1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Mdh1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-MDH1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MDH1 |
MDH1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MDH1 |
MDH1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-334 of human MDH1 (NP_005908.1). |
| Modifications | Unmodified |
Transient overexpression of MDH1 (NM_005917) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MDH1 (NM_001199112) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MDH1 (NM_001199111) in HEK293T cells paraffin embedded controls for ICC/IHC staining
MDH1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
MDH1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Mdh1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Mdh1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Mdh1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Mdh1 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse malate dehydrogenase 1, NAD (soluble) (Mdh1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
Recombinant protein of human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 1.
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 1.
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 1.
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 1.
| Tag | C-His |
| Expression Host | E. coli |
MDH1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Mdh1 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Mdh1 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of MDH1 (NM_005917) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Germany
Japan
United Kingdom
China
