Germany
Japan
United Kingdom
China
MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti-ORF clone of MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,700.00
9 Weeks
Lenti ORF particles, MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,700.00
9 Weeks
Lenti ORF particles, MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MECOM (GFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MECOM (GFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 6
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MECOM (GFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MECOM (GFP-tagged) - Homo sapiens MDS1 and EVI1 complex locus (MECOM), transcript variant 7
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Mecom (Myc-DDK-tagged ORF) - Rat ecotropic viral integration site 1 (Evi1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Mecom (Myc-DDK-tagged ORF) - Rat ecotropic viral integration site 1 (Evi1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mecom (Myc-DDK-tagged ORF) - Rat ecotropic viral integration site 1 (Evi1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mecom (mGFP-tagged ORF) - Rat ecotropic viral integration site 1 (Evi1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mecom (GFP-tagged ORF) - Rat ecotropic viral integration site 1 (Evi1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MECOM - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Mecom (mGFP-tagged) - Mouse MDS1 and EVI1 complex locus (Mecom), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Mecom (mGFP-tagged) - Mouse MDS1 and EVI1 complex locus (Mecom), transcript variant 2
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
MECOM (untagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MECOM (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
qSTAR qPCR primer pairs against Mus musculus gene Mecom
Rabbit anti-MECOM Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MECOM |
Rabbit Polyclonal Anti-EVI1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the middle region of human EVI1. Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT |
Rabbit Polyclonal Anti-EVI1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the middle region of human EVI1. Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT |
Rabbit Polyclonal Anti-EVI1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the N terminal of human EVI1. Synthetic peptide located within the following region: VKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPSVGDNKPVELQP |
Mecom (untagged) - Mouse MDS1 and EVI1 complex locus (Mecom), transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Mecom (Myc-DDK-tagged) - Mouse MDS1 and EVI1 complex locus (Mecom), transcript variant 1
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Mecom (Myc-DDK-tagged) - Mouse MDS1 and EVI1 complex locus (Mecom), transcript variant 2
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Mecom (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal EVI1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal EVI1 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody was made against a protein fragment from the N Terminus Region |
Rabbit Polyclonal EVI1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
MECOM HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal anti-EVI1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the C terminal of human EVI1. Synthetic peptide located within the following region: HFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMML |
Mecom - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vectorr
| Format | Retroviral plasmids |
| Vector | pRS |
EVI1 (MECOM) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human EVI1. |
EVI1 (MECOM) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 80-109 amino acids from the Central region of human MDS1 |
MECOM HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of MDS1 and EVI1 complex locus (MECOM), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
3`UTR clone of MDS1 and EVI1 complex locus (MECOM) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Goat Anti-EVI1 / AML1 (MECOM) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKESLHSTSH, from the internal region of the protein sequence according to NP_001098547.3; NP_005232.2; NP_004982.2; NP_001157471.1; NP_001157472.1. |
Rabbit Polyclonal Anti-MDS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MDS1 antibody: synthetic peptide directed towards the N terminal of human MDS1. Synthetic peptide located within the following region: MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPA |
MECOM - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
MECOM - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
MDS1 (1-169, His-tag) human protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Active filters
Target Symbol
- MECOM