Products

cDNA Clones (92)
Proteins (12)
RNAi (12)
Gene Expression (7)
Antibodies (5)
Jump to Filters
View as table Download
Pde1c (NM_001159957) Mouse Tagged ORF Clone
MR217717

USD 630.00

2 Weeks

Pde1c (Myc-DDK-tagged) - Mouse phosphodiesterase 1C (Pde1c), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pde1c (NM_001159957) Mouse Tagged ORF Clone
MR217717L3

USD 830.00

8 Weeks

Lenti ORF clone of Pde1c (Myc-DDK-tagged) - Mouse phosphodiesterase 1C (Pde1c), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pde1c (NM_001159957) Mouse Tagged ORF Clone Lentiviral Particle
MR217717L3V

USD 1,030.00

11 Weeks

Lenti ORF particles, Pde1c (Myc-DDK-tagged) - Mouse phosphodiesterase 1C (Pde1c), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pde1c (NM_001159957) Mouse Tagged ORF Clone
MR217717L4

USD 830.00

8 Weeks

Lenti ORF clone of Pde1c (mGFP-tagged) - Mouse phosphodiesterase 1C (Pde1c), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pde1c (NM_001159957) Mouse Tagged ORF Clone Lentiviral Particle
MR217717L4V

USD 1,030.00

11 Weeks

Lenti ORF particles, Pde1c (GFP-tagged) - Mouse phosphodiesterase 1C (Pde1c), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_005020) Human Tagged ORF Clone
RC205291L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_005020) Human Tagged ORF Clone Lentiviral Particle
RC205291L3V

USD 820.00

5 Weeks

Lenti ORF particles, PDE1C (Myc-DDK tagged) - Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_005020) Human Tagged ORF Clone
RC205291L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_005020) Human Tagged ORF Clone Lentiviral Particle
RC205291L4V

USD 820.00

7 Weeks

Lenti ORF particles, PDE1C (mGFP-tagged) - Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191057) Human Tagged ORF Clone
RC231386

USD 610.00

4 Weeks

PDE1C (Myc-DDK-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_001191057) Human Tagged ORF Clone
RC231386L3

USD 810.00

4 Weeks

Lenti-ORF clone of PDE1C (Myc-DDK-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191057) Human Tagged ORF Clone Lentiviral Particle
RC231386L3V

USD 1,010.00

7 Weeks

Lenti ORF particles, PDE1C (Myc-DDK-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191057) Human Tagged ORF Clone
RC231386L4

USD 810.00

4 Weeks

Lenti-ORF clone of PDE1C (mGFP-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191057) Human Tagged ORF Clone Lentiviral Particle
RC231386L4V

USD 1,010.00

7 Weeks

Lenti ORF particles, PDE1C (mGFP-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191058) Human Tagged ORF Clone
RC231408

USD 860.00

4 Weeks

PDE1C (Myc-DDK-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_001191058) Human Tagged ORF Clone
RC231408L3

USD 1,060.00

4 Weeks

Lenti-ORF clone of PDE1C (Myc-DDK-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191058) Human Tagged ORF Clone Lentiviral Particle
RC231408L3V

USD 1,260.00

7 Weeks

Lenti ORF particles, PDE1C (Myc-DDK-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191058) Human Tagged ORF Clone
RC231408L4

USD 1,060.00

4 Weeks

Lenti-ORF clone of PDE1C (mGFP-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191058) Human Tagged ORF Clone Lentiviral Particle
RC231408L4V

USD 1,260.00

7 Weeks

Lenti ORF particles, PDE1C (mGFP-tagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_001191059) Human Tagged ORF Clone
RC233095

USD 610.00

4 Weeks

PDE1C (Myc-DDK tagged) - Homo sapiens phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_001191057) Human Tagged ORF Clone
RG231386

USD 670.00

5 Weeks

PDE1C (GFP-tagged) - Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_001191058) Human Tagged ORF Clone
RG231408

USD 950.00

5 Weeks

PDE1C (GFP-tagged) - Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_001191056) Human Tagged ORF Clone
RG233033

USD 740.00

3 Weeks

PDE1C (GFP-tagged) - Homo sapiens phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDE1C (NM_001191059) Human Tagged ORF Clone
RG233095

USD 670.00

4 Weeks

PDE1C (GFP-tagged) - Homo sapiens phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pde1c (NM_031078) Rat Tagged ORF Clone
RR204571

USD 1,040.00

5 Weeks

Pde1c (Myc-DDK-tagged ORF) - Rat phosphodiesterase 1C (Pde1c), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pde1c (NM_031078) Rat Tagged ORF Clone
RR204571L3

USD 1,230.00

12 Weeks

Lenti ORF clone of Pde1c (Myc-DDK-tagged ORF) - Rat phosphodiesterase 1C (Pde1c), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pde1c (NM_031078) Rat Tagged ORF Clone Lentiviral Particle
RR204571L3V

USD 1,440.00

16 Weeks

Lenti ORF particles, Pde1c (Myc-DDK-tagged ORF) - Rat phosphodiesterase 1C (Pde1c), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pde1c (NM_031078) Rat Tagged ORF Clone
RR204571L4

USD 1,350.00

12 Weeks

Lenti ORF clone of Pde1c (mGFP-tagged ORF) - Rat phosphodiesterase 1C (Pde1c), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pde1c (NM_031078) Rat Tagged ORF Clone Lentiviral Particle
RR204571L4V

USD 1,610.00

16 Weeks

Lenti ORF particles, Pde1c (GFP-tagged ORF) - Rat phosphodiesterase 1C (Pde1c), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDE1C (NM_005020) Human Recombinant Protein
TP760557

USD 215.00

In Stock

Purified recombinant protein of Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
PDE1C (NM_005020) Human Tagged Lenti ORF Clone
RC205291L1

USD 768.00

In Stock

Lenti ORF clone of Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Pde1c (NM_001159953) Mouse Untagged Clone
MC220741

USD 960.00

In Stock

Pde1c (untagged) - Mouse phosphodiesterase 1C (Pde1c), transcript variant 4, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PDE1C (NM_005020) Human Tagged ORF Clone
RC205291L2

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PDE1C (NM_005020) Human Untagged Clone
SC124021

USD 1,070.00

In Stock

PDE1C (untagged)-Human phosphodiesterase 1C, calmodulin-dependent 70kDa (PDE1C), transcript variant 4

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC124021 is the updated version of SC117013.
PDE1C Human shRNA Plasmid Kit (Locus ID 5137)
TL310551

USD 815.00

In Stock

PDE1C - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
PDE1C Rabbit Polyclonal Antibody
TA317146

USD 425.00

5 Days

Phosphodiesterase 1c / PDE1C Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Horse, Gibbon
Conjugation Unconjugated
Immunogen PDE1C antibody was raised against synthetic 16 amino acid peptide from C-terminus of human PDE1C. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit (100%); Opossum (88%).
PDE1C Rabbit Polyclonal Antibody
TA335728

USD 375.00

5 Days

Rabbit Polyclonal Anti-PDE1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDE1C Antibody: synthetic peptide directed towards the N terminal of human PDE1C. Synthetic peptide located within the following region: DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLAST
PDE1C Rabbit Polyclonal Antibody
TA342232

USD 375.00

5 Days

Rabbit polyclonal Anti-PDE1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE1C antibody: synthetic peptide directed towards the middle region of human PDE1C. Synthetic peptide located within the following region: IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
Human PDE1C activation kit by CRISPRa
GA103434

USD 1,290.00

2 Weeks

PDE1C CRISPRa kit - CRISPR gene activation of human phosphodiesterase 1C

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Pde1c activation kit by CRISPRa
GA203143

USD 1,290.00

2 Weeks

Pde1c CRISPRa kit - CRISPR gene activation of mouse phosphodiesterase 1C

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
PDE1C Human qPCR Template Standard (NM_005020)
HK209618

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene PDE1C

Application Plasmid of exact quantity for transcript copy number calculation
PDE1C Human qPCR Primer Pair (NM_005020)
HP208237

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene PDE1C

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Pde1c (NM_001159960) Mouse Untagged Clone
MC218217

USD 730.00

3 Weeks

Pde1c (untagged) - Mouse phosphodiesterase 1C (Pde1c), transcript variant 8, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Pde1c (NM_001159957) Mouse Untagged Clone
MC219513

USD 810.00

3 Weeks

Pde1c (untagged) - Mouse phosphodiesterase 1C (Pde1c), transcript variant 5, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Pde1c (NM_001159956) Mouse Untagged Clone
MC219708

USD 830.00

3 Weeks

Pde1c (untagged) - Mouse phosphodiesterase 1C (Pde1c), transcript variant 6, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Pde1c (NM_001159952) Mouse Untagged Clone
MC219809

USD 840.00

3 Weeks

Pde1c (untagged) - Mouse phosphodiesterase 1C (Pde1c), transcript variant 3, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Pde1c (NM_001025568) Mouse Untagged Clone
MC219905

USD 850.00

3 Weeks

Pde1c (untagged) - Mouse phosphodiesterase 1C (Pde1c), transcript variant 2, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Pde1c (NM_001159955) Mouse Untagged Clone
MC220163

USD 890.00

3 Weeks

Pde1c (untagged) - Mouse phosphodiesterase 1C (Pde1c), transcript variant 7, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Pde1c (NM_011054) Mouse Untagged Clone
MC220164

USD 890.00

3 Weeks

Pde1c (untagged) - Mouse phosphodiesterase 1C (Pde1c), transcript variant 1, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Pde1c Mouse qPCR Primer Pair (NM_011054)
MP210886

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Pde1c