Rabbit Polyclonal Anti-RAP1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAP1B Antibody: synthetic peptide directed towards the N terminal of human RAP1B. Synthetic peptide located within the following region: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ |
Rap1b - Rat, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
RAP1B (1-181, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
RAP1B (1-181, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
RAP1B CRISPRa kit - CRISPR gene activation of human RAP1B, member of RAS oncogene family
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Rap1b CRISPRa kit - CRISPR gene activation of mouse RAS related protein 1b
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene RAP1B
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene RAP1B
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
RAP1B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RAP1B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rap1b (untagged) - Mouse RAS related protein 1b (Rap1b), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Rap1b
RAP1B MS Standard C13 and N15-labeled recombinant protein (NP_001010942)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rap1b (untagged ORF) - Rat RAP1B, member of RAS oncogene family (Rap1b), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of RAP1B member of RAS oncogene family (RAP1B) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of RAP1B member of RAS oncogene family (RAP1B) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
RAP1B (untagged)-Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
RAP1B (untagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
RAP1B (untagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
RAP1B (untagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 5
| Vector | pCMV6 series |
| Tag | Tag Free |
RAP1B (untagged) - Homo sapiens RAP1B, member of RAS oncogene family (RAP1B), transcript variant 6
| Vector | pCMV6 series |
| Tag | Tag Free |
Rap1b (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-RAP1B Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
RAP1B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RAP1B |
Rap1B Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human Rap1B (NP_056461.1). |
| Modifications | Unmodified |
RAP1 Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression of RAP1B (NM_015646) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAP1B (NM_001010942) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAP1B (NM_001251922) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAP1B (NM_001251917) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAP1B (NM_001251918) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAP1B (NM_001251921) in HEK293T cells paraffin embedded controls for ICC/IHC staining
RAP1B - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Rap1b - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Rap1b - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Rap1b - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Rap1b - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse RAS related protein 1b (Rap1b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
Rap1b - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Rap1b - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of RAP1B (NM_015646) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RAP1B (NM_015646) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RAP1B (NM_001010942) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RAP1B (NM_001010942) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RAP1B (NM_001251922) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RAP1B (NM_001251917) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RAP1B (NM_001251918) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Germany
Japan
United Kingdom
China
