Products

cDNA Clones (11)
Antibodies (6)
Proteins (5)
Jump to Filters
View as table Download
MRP1 (ABCC1) (NM_004996) Human Tagged ORF Clone
RC218182

USD 1,270.00

In Stock

ABCC1 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MRP1 (ABCC1) (NM_004996) Human Tagged ORF Clone Lentiviral Particle
RC218182L1V

USD 1,670.00

3 Weeks

Lenti ORF particles, ABCC1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
MRP1 (ABCC1) (NM_004996) Human Tagged ORF Clone Lentiviral Particle
RC218182L2V

USD 1,670.00

6 Weeks

Lenti ORF particles, ABCC1 (mGFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
MRP1 (ABCC1) (NM_004996) Human Tagged ORF Clone
RG218182

USD 1,400.00

In Stock

ABCC1 (GFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MRP1 (ABCC1) (NM_004996) Human Tagged ORF Clone
RC218182L3

USD 1,470.00

3 Weeks

Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MRP1 (ABCC1) (NM_004996) Human Tagged ORF Clone Lentiviral Particle
RC218182L3V

USD 1,670.00

5 Weeks

Lenti ORF particles, ABCC1 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MRP1 (ABCC1) (NM_004996) Human Tagged ORF Clone
RC218182L4

USD 1,470.00

In Stock

Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MRP1 (ABCC1) (NM_004996) Human Tagged ORF Clone Lentiviral Particle
RC218182L4V

USD 1,670.00

3 Weeks

Lenti ORF particles, ABCC1 (mGFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MRP1 (ABCC1) (NM_004996) Human Untagged Clone
SC109450

USD 3,100.00

In Stock

ABCC1 (untagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
MRP1 (ABCC1) Mouse Monoclonal Antibody [Clone ID: IU5C1]
TA309560

USD 424.00

2 Weeks

Mouse Monoclonal MRP1 Antibody (IU5C1)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
MRP1 (ABCC1) (NM_004996) Human Over-expression Lysate
LC417598

USD 187.00

In Stock

ABCC1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MRP1 (ABCC1) (NM_004996) Human Over-expression Lysate
LY417598

USD 605.00

In Stock

Transient overexpression lysate of ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MRP1 (ABCC1) (NM_019902) Human Untagged Clone
SC124215

USD 660.00

In Stock

ABCC1 (untagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 7

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
MRP1 (ABCC1) Goat Polyclonal Antibody
TA305869

USD 375.00

2 Weeks

Goat Anti-ABCC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HQSDLKVDENQKAYY, from the internal region of the protein sequence according to NP_004987.2; NP_063915.2; NP_063953.2;NP_063954.2; NP_063955.2.
MRP1 (ABCC1) (NM_004996) Human Tagged ORF Clone
RC218182L2

USD 1,470.00

3 Weeks

Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
MRP1 (ABCC1) Rabbit Polyclonal Antibody
TA332082

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABCC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCC1 Antibody: synthetic peptide directed towards the middle region of human ABCC1. Synthetic peptide located within the following region: LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA
MRP1 (ABCC1) Rabbit Polyclonal Antibody
TA322683

USD 345.00

4 Weeks

Anti-ABCC1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1
MRP1 (ABCC1) Rabbit Polyclonal Antibody
TA322684

USD 345.00

4 Weeks

Anti-ABCC1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1
MRP1 (ABCC1) Rabbit Polyclonal Antibody
TA352000

USD 345.00

In Stock

Rabbit Polyclonal Anti-ABCC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABCC1
MRP1 (ABCC1) ICC Control Block
TB418182

USD 1,920.00

4 Weeks

Transient overexpression of ABCC1 (NM_004996) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MRP1 (ABCC1) Cytosection
TS418182

USD 225.00

4 Weeks

Transient overexpression of ABCC1 (NM_004996) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

MRP1 (ABCC1) Cytosection
TS418182P5

USD 889.00

4 Weeks

Transient overexpression of ABCC1 (NM_004996) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack