Germany
Japan
United Kingdom
China
CMAS (Myc-DDK-tagged)-Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CMAS (mGFP-tagged) - Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, CMAS (Myc-DDK tagged) - Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CMAS (mGFP-tagged) - Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CMAS (GFP-tagged) - Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CMAS (Myc-DDK tagged) - Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-CMAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CMAS antibody: synthetic peptide directed towards the N terminal of human CMAS. Synthetic peptide located within the following region: GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF |
Lenti ORF clone of Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CMAS HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CMAS (untagged)-Human cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-CMAS antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CMAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 300-327 amino acids from the C-terminal region of human CMAS. |
CMAS MS Standard C13 and N15-labeled recombinant protein (NP_061156)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of CMAS (NM_018686) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CMAS (NM_018686) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CMAS (NM_018686) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CMAS
Pathways
- Amino sugar and nucleotide sugar metabolism