Products

View as table Download

RAB5A (Myc-DDK-tagged)-Human RAB5A, member RAS oncogene family (RAB5A)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

RAB5A (GFP-tagged) - Human RAB5A, member RAS oncogene family (RAB5A)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Recombinant protein of human RAB5A, member RAS oncogene family (RAB5A)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

RAB5A (myc-DDK-tagged) - Human RAB5A, member RAS oncogene family (RAB5A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

USD 320.00

In Stock

Goat Polyclonal Anti-Rab5a Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a produced in E. coli.

RAB5A (untagged)-Human RAB5A, member RAS oncogene family (RAB5A)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

USD 300.00

In Stock

Goat Polyclonal Anti-Rab5 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a, Rab5b and rab5c produced in E. coli.

Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit anti-RAB5A Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RAB5A

RAB5A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit polyclonal Rab5 Antibody

Applications IF, WB
Reactivities Human, Mouse, Monkey, Bovine, Rat. Not tested in other species
Conjugation Unconjugated
Immunogen Human Rab5 synthetic peptide conjugated to KLH; identical to dog Rab5 sequence over the residues

Rabbit polyclonal Rab5 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Rab5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-211 amino acids from the C-terminal region of human Rab5.

Rabbit Polyclonal Anti-Rab5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rab5 Antibody: Peptide sequence around aa.188~192( N-P-G-A-N) derived from Human Rab5.

Rabbit Polyclonal Anti-Rab5A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rab5A Antibody: A synthesized peptide derived from human Rab5A

USD 320.00

In Stock

Goat Polyclonal Anti-Rab5a Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a produced in E. coli.

Lenti ORF clone of Human RAB5A, member RAS oncogene family (RAB5A), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

RAB5A (untagged)-Human RAB5A, member RAS oncogene family (RAB5A)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit polyclonal Anti-RAB5A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS

Rabbit polyclonal Rab4 Antibody

Applications WB
Reactivities Human, Mouse, Rat. Not yet tested on other species
Conjugation Unconjugated
Immunogen C-terminal peptide from human Rab4

Rabbit polyclonal Anti-RAB5A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS

RAB5A / RAB5 (1-215) human recombinant protein, 0.5 mg

Expression Host E. coli

RAB5A / RAB5 (1-215) human recombinant protein, 0.1 mg

Expression Host E. coli

Carrier-free (BSA/glycerol-free) RAB5A mouse monoclonal antibody,clone OTI6D9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RAB5A MS Standard C13 and N15-labeled recombinant protein (NP_004153)

Tag C-Myc/DDK
Expression Host HEK293

RAB5A (GFP-tagged) - Human RAB5A, member RAS oncogene family (RAB5A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

RAB5A (untagged) - Human RAB5A, member RAS oncogene family (RAB5A), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Anti-RAB5A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-16 amino acids of Human Ras-related protein Rab-5A

Anti-RAB5A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-16 amino acids of Human Ras-related protein Rab-5A

RAB5A mouse monoclonal antibody,clone OTI6D9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RAB5A mouse monoclonal antibody,clone OTI6D9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Transient overexpression of RAB5A (NM_004162) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of RAB5A (NM_001292048) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of RAB5A (NM_004162) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of RAB5A (NM_004162) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of RAB5A (NM_001292048) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack