Germany
Japan
United Kingdom
China
IFI30 (Myc-DDK-tagged)-Human interferon, gamma-inducible protein 30 (IFI30)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Purified recombinant protein of Homo sapiens interferon, gamma-inducible protein 30 (IFI30)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
IFI30 (GFP-tagged) - Human interferon, gamma-inducible protein 30 (IFI30)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human interferon, gamma-inducible protein 30 (IFI30), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IFI30 (Myc-DDK tagged) - Human interferon, gamma-inducible protein 30 (IFI30), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interferon, gamma-inducible protein 30 (IFI30), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IFI30 (mGFP-tagged) - Human interferon, gamma-inducible protein 30 (IFI30), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
IFI30 / GILT (58-232, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of interferon, gamma-inducible protein 30 (IFI30)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
IFI30 (untagged)-Human interferon, gamma-inducible protein 30 (IFI30)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
IFI30 / GILT (58-232, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
IFI30 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-IFI30 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFI30 antibody is: synthetic peptide directed towards the middle region of Human IFI30. Synthetic peptide located within the following region: YGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCME |
IFI30 MS Standard C13 and N15-labeled recombinant protein (NP_006323)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of IFI30 (NM_006332) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IFI30 (NM_006332) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IFI30 (NM_006332) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- IFI30
Pathways
- Antigen processing and presentation