Germany
Japan
United Kingdom
China
IFI30 (Myc-DDK-tagged)-Human interferon, gamma-inducible protein 30 (IFI30)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Purified recombinant protein of Homo sapiens interferon, gamma-inducible protein 30 (IFI30)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Ifi30 (Myc-DDK-tagged) - Mouse interferon gamma inducible protein 30 (Ifi30)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IFI30 (GFP-tagged) - Human interferon, gamma-inducible protein 30 (IFI30)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IFI30 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN405877 is the updated version of KN205877.
Ifi30 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508109 is the updated version of KN308109.
Ifi30 (GFP-tagged) - Mouse interferon gamma inducible protein 30 (Ifi30)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ifi30 (Myc-DDK-tagged) - Mouse interferon gamma inducible protein 30 (Ifi30)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ifi30 (Myc-DDK-tagged) - Mouse interferon gamma inducible protein 30 (Ifi30), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ifi30 (mGFP-tagged) - Mouse interferon gamma inducible protein 30 (Ifi30)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ifi30 (GFP-tagged) - Mouse interferon gamma inducible protein 30 (Ifi30), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interferon, gamma-inducible protein 30 (IFI30), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IFI30 (Myc-DDK tagged) - Human interferon, gamma-inducible protein 30 (IFI30), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interferon, gamma-inducible protein 30 (IFI30), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IFI30 (mGFP-tagged) - Human interferon, gamma-inducible protein 30 (IFI30), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ifi30 (Myc-DDK-tagged ORF) - Rat interferon gamma inducible protein 30 (Ifi30), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ifi30 (Myc-DDK-tagged ORF) - Rat interferon gamma inducible protein 30 (Ifi30), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ifi30 (Myc-DDK-tagged ORF) - Rat interferon gamma inducible protein 30 (Ifi30), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ifi30 (mGFP-tagged ORF) - Rat interferon gamma inducible protein 30 (Ifi30), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ifi30 (GFP-tagged ORF) - Rat interferon gamma inducible protein 30 (Ifi30), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
IFI30 / GILT (58-232, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of interferon, gamma-inducible protein 30 (IFI30)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Ifi30 (untagged) - Mouse interferon gamma inducible protein 30 (Ifi30), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
IFI30 (untagged)-Human interferon, gamma-inducible protein 30 (IFI30)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
IFI30 / GILT (58-232, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
Ifi30 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
qPCR primer pairs and template standards against Homo sapiens gene IFI30
| Application | Plasmid of exact quantity for transcript copy number calculation |
IFI30 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-IFI30 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFI30 antibody is: synthetic peptide directed towards the middle region of Human IFI30. Synthetic peptide located within the following region: YGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCME |
IFI30 CRISPRa kit - CRISPR gene activation of human IFI30 lysosomal thiol reductase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ifi30 CRISPRa kit - CRISPR gene activation of mouse interferon gamma inducible protein 30
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene IFI30
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene IFI30
qPCR primer pairs and template standards against Mus musculus gene Ifi30
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Ifi30
IFI30 MS Standard C13 and N15-labeled recombinant protein (NP_006323)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Ifi30 (untagged ORF) - Rat interferon gamma inducible protein 30 (Ifi30), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of interferon gamma-inducible protein 30 (IFI30) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
IFI30 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Ifi30 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
IFI30 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human IFI30 (NP_006323.2). |
| Modifications | Unmodified |
Transient overexpression of IFI30 (NM_006332) in HEK293T cells paraffin embedded controls for ICC/IHC staining
IFI30 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
IFI30 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Ifi30 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Ifi30 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Ifi30 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Ifi30 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse interferon gamma inducible protein 30 (Ifi30), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
Active filters
Target Symbol
- IFI30