Germany
Japan
United Kingdom
China
NFYA (Myc-DDK-tagged)-Human nuclear transcription factor Y, alpha (NFYA), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
NFYA (Myc-DDK-tagged)-Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, NFYA (Myc-DDK tagged) - Human nuclear transcription factor Y, alpha (NFYA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NFYA (mGFP-tagged) - Human nuclear transcription factor Y, alpha (NFYA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
NFYA (untagged)-Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
NFYA (GFP-tagged) - Human nuclear transcription factor Y, alpha (NFYA), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NFYA (GFP-tagged) - Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NFYA (Myc-DDK tagged) - Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NFYA (mGFP-tagged) - Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NFYA (Myc-DDK tagged) - Human nuclear transcription factor Y, alpha (NFYA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NFYA (mGFP-tagged) - Human nuclear transcription factor Y, alpha (NFYA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NFYA (untagged)-Human nuclear transcription factor Y, alpha (NFYA), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of nuclear transcription factor Y, alpha (NFYA), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Recombinant protein of human nuclear transcription factor Y, alpha (NFYA), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Purified recombinant protein of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Lenti ORF clone of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-NFYA antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NFYA. |
NFYA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal anti-NFYA antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFYA antibody: synthetic peptide directed towards the C terminal of human NFYA. Synthetic peptide located within the following region: YLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS |
Rabbit Polyclonal anti-NFYA antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFYA antibody: synthetic peptide directed towards the C terminal of human NFYA. Synthetic peptide located within the following region: YLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS |
Rabbit polyclonal anti-NF-Y antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-NF-Y (A) antibody was produced by repeated immunizations with a synthetic NF-Y (A subunit) peptide corresponding to a region near the N-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Purified recombinant protein of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2
| Tag | N-GST |
| Expression Host | E. coli |
Purified recombinant protein of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2
| Tag | tag free |
| Expression Host | E. coli |
NFYA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of nuclear transcription factor Y, alpha (NFYA), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression of NFYA (NM_021705) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NFYA (NM_002505) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2
| Tag | N-GST |
| Expression Host | E. coli |
Purified recombinant protein of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2
| Tag | N-GST |
| Expression Host | E. coli |
Purified recombinant protein of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2
| Tag | N-GST |
| Expression Host | E. coli |
Purified recombinant protein of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2
| Tag | tag free |
| Expression Host | E. coli |
Purified recombinant protein of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2
| Tag | tag free |
| Expression Host | E. coli |
Purified recombinant protein of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2
| Tag | tag free |
| Expression Host | E. coli |
Transient overexpression of NFYA (NM_021705) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NFYA (NM_021705) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of NFYA (NM_002505) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NFYA (NM_002505) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- NFYA
Pathways
- Antigen processing and presentation