TRADD (Myc-DDK-tagged)-Human TNFRSF1A-associated via death domain (TRADD)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TRADD (Myc-DDK-tagged)-Human TNFRSF1A-associated via death domain (TRADD)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, TRADD (Myc-DDK tagged) - Human TNFRSF1A-associated via death domain (TRADD), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, TRADD (mGFP-tagged) - Human TNFRSF1A-associated via death domain (TRADD), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
TRADD (GFP-tagged) - Human TNFRSF1A-associated via death domain (TRADD)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human TNFRSF1A-associated via death domain (TRADD), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TRADD (Myc-DDK tagged) - Human TNFRSF1A-associated via death domain (TRADD), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human TNFRSF1A-associated via death domain (TRADD), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TRADD (mGFP-tagged) - Human TNFRSF1A-associated via death domain (TRADD), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TRADD (untagged)-Human TNFRSF1A-associated via death domain (TRADD)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of TNFRSF1A-associated via death domain (TRADD)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit anti-TRADD Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TRADD |
TRADD (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 133-159 amino acids from the Central region of human TRADD |
Rabbit polyclonal anti-TRADD antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TRADD. |
Rabbit Polyclonal Anti-TRADD Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRADD Antibody: A synthesized peptide derived from human TRADD |
TRADD HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human TNFRSF1A-associated via death domain (TRADD), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human TNFRSF1A-associated via death domain (TRADD), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal antibody to TRADD (TNFRSF1A-associated via death domain)
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 43 of TRADD (Uniprot ID#Q15628) |
Rabbit Polyclonal Anti-TRADD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRADD antibody: synthetic peptide directed towards the middle region of human TRADD. Synthetic peptide located within the following region: YEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGL |
Transient overexpression of TRADD (NM_003789) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TRADD (NM_003789) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TRADD (NM_003789) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack