Germany
Japan
United Kingdom
China
CKM (Myc-DDK-tagged)-Human creatine kinase, muscle (CKM)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human creatine kinase, muscle (CKM)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, CKM (Myc-DDK tagged) - Human creatine kinase, muscle (CKM), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, CKM (mGFP-tagged) - Human creatine kinase, muscle (CKM), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CKM (GFP-tagged) - Human creatine kinase, muscle (CKM)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human creatine kinase, muscle (CKM), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CKM (Myc-DDK tagged) - Human creatine kinase, muscle (CKM), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human creatine kinase, muscle (CKM), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, CKM (mGFP-tagged) - Human creatine kinase, muscle (CKM), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 315.00
2 Weeks
Creatine kinase M type (CKM) mouse monoclonal antibody, clone A12E3-15-12, Purified
| Applications | ELISA |
| Reactivities | Human |
Goat Polyclonal Anti-creatine kinase M-type (aa258-270) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Pig (Expected from sequence similarity: Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-creatine kinase M-type (aa258-270) Antibody: Peptide with sequence C-QKIEEIFKKAGHP, from the internal region of the protein sequence according to NP_001815.2. |
CKM (untagged)-Human creatine kinase, muscle (CKM)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CKM Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CKM antibody: synthetic peptide directed towards the N terminal of human CKM. Synthetic peptide located within the following region: VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL |
Rabbit Polyclonal Anti-CKM Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CKM antibody: synthetic peptide directed towards the middle region of human CKM. Synthetic peptide located within the following region: GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI |
Lenti ORF clone of Human creatine kinase, muscle (CKM), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human creatine kinase, muscle (CKM), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CKM (untagged)-Human creatine kinase, muscle (CKM)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CKM HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Purified recombinant heterodimer protein of Human CKMB(full length creatine kinase, muscle (CKM) with N-terminal GST tag, and full length creatine kinase, brain (CKB), with N-terminal His(CKB) tag), expressed in E.coli, 100ug
| Tag | N-GST(CKM) and N-His(CKB) |
| Expression Host | E. coli |
USD 360.00
2 Weeks
Creatine kinase M type (CKM) mouse monoclonal antibody, clone 027-17186, Purified
| Applications | ELISA |
| Reactivities | Human |
Creatine kinase M type (CKM) goat polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Purified CK-MM from human skeletal muscle |
CKMM human protein, 1 mg
| Protein Source | Skeletal muscle |
CKMM Type 3 human recombinant protein, 1 mg
| Expression Host | Pichia pastoris |
CKMM Type 1 human recombinant protein, 1 mg
| Expression Host | Pichia pastoris |
Transient overexpression lysate of creatine kinase, muscle (CKM)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CKM MS Standard C13 and N15-labeled recombinant protein (NP_001815)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of CKM (NM_001824) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human creatine kinase, muscle (CKM)
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human creatine kinase, muscle (CKM)
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human creatine kinase, muscle (CKM)
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human creatine kinase, muscle (CKM)
| Tag | C-His |
| Expression Host | HEK293 |
Transient overexpression of CKM (NM_001824) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CKM (NM_001824) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CKM
Pathways
- Arginine and proline metabolism