Germany
Japan
United Kingdom
China
PYCR2 (Myc-DDK-tagged)-Human pyrroline-5-carboxylate reductase family, member 2 (PYCR2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human pyrroline-5-carboxylate reductase family, member 2 (PYCR2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, PYCR2 (Myc-DDK tagged) - Human pyrroline-5-carboxylate reductase family, member 2 (PYCR2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PYCR2 (mGFP-tagged) - Human pyrroline-5-carboxylate reductase family, member 2 (PYCR2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PYCR2 (GFP-tagged) - Human pyrroline-5-carboxylate reductase family, member 2 (PYCR2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human pyrroline-5-carboxylate reductase family, member 2 (PYCR2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PYCR2 (Myc-DDK tagged) - Human pyrroline-5-carboxylate reductase family, member 2 (PYCR2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human pyrroline-5-carboxylate reductase family, member 2 (PYCR2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PYCR2 (mGFP-tagged) - Human pyrroline-5-carboxylate reductase family, member 2 (PYCR2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PYCR2 (Myc-DDK tagged) - Homo sapiens pyrroline-5-carboxylate reductase family, member 2 (PYCR2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PYCR2 (GFP-tagged) - Homo sapiens pyrroline-5-carboxylate reductase family, member 2 (PYCR2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human pyrroline-5-carboxylate reductase family, member 2 (PYCR2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of pyrroline-5-carboxylate reductase family, member 2 (PYCR2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human pyrroline-5-carboxylate reductase family, member 2 (PYCR2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PYCR2 (untagged)-Human pyrroline-5-carboxylate reductase family, member 2 (PYCR2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PYCR2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PYCR2 (untagged)-Human pyrroline-5-carboxylate reductase family, member 2 (PYCR2)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PYCR2 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the middle region of human PYCR2. Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE |
Rabbit Polyclonal Anti-PYCR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the C terminal of human PYCR2. Synthetic peptide located within the following region: LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS |
PYCR2 (1-320, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
PYCR2 (1-320, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
PYCR2 MS Standard C13 and N15-labeled recombinant protein (NP_037460)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PYCR2 (untagged) - Homo sapiens pyrroline-5-carboxylate reductase family, member 2 (PYCR2), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- PYCR2
Pathways
- Arginine and proline metabolism