CACNB1 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CACNB1 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CACNB1 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CACNB1 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, CACNB1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CACNB1 (mGFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, CACNB1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CACNB1 (mGFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CACNB1 (GFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CACNB1 (GFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CACNB1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CACNB1 (mGFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CACNB1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CACNB1 (mGFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CACNB1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CACNB1 (mGFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CACNB1 (GFP-tagged) - Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CACNB1 (untagged)-Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CACNB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CACNB1 |
Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CACNB1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CACNB1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CACNB1 (untagged)-Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CACNB1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP |
CACNB1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 542-572 amino acids from the C-terminal region of human CACNB1 |
Rabbit Polyclonal Anti-CACNB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS |
Rabbit Polyclonal Anti-CACNB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: DWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSS |
Rabbit Polyclonal Anti-CACNB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE |
Rabbit Polyclonal Anti-CACNB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the C terminal of human CACNB1. Synthetic peptide located within the following region: RTMATAALAASPAPVSNLQVQVLTSLRRNLGFWGGLESSQRGSVVPQEQE |
Carrier-free (BSA/glycerol-free) CACNB1 mouse monoclonal antibody,clone OTI3H6
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
CACNB1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CACNB1 MS Standard C13 and N15-labeled recombinant protein (NP_000714)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CACNB1 MS Standard C13 and N15-labeled recombinant protein (NP_954855)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CACNB1 (untagged)-Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CACNB1 mouse monoclonal antibody,clone OTI3H6
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CACNB1 mouse monoclonal antibody,clone OTI3H6, Biotinylated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
CACNB1 mouse monoclonal antibody,clone OTI3H6, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
CACNB1 mouse monoclonal antibody,clone OTI3H6
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |