Products

cDNA Clones (12)
Proteins (11)
Antibodies (10)
Jump to Filters
View as table Download
G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Tagged ORF Clone
RC205289

USD 420.00

In Stock

GNAI1 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Recombinant Protein
TP305289

USD 823.00

In Stock

Recombinant protein of human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1)

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Tagged ORF Clone Lentiviral Particle
RC205289L1V

USD 820.00

3 Weeks

Lenti ORF particles, GNAI1 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Tagged ORF Clone Lentiviral Particle
RC205289L2V

USD 820.00

6 Weeks

Lenti ORF particles, GNAI1 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Tagged ORF Clone
RC205289L3

USD 620.00

3 Weeks

Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Tagged ORF Clone Lentiviral Particle
RC205289L3V

USD 820.00

7 Weeks

Lenti ORF particles, GNAI1 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Tagged ORF Clone Lentiviral Particle
RC205289L4V

USD 820.00

3 Weeks

Lenti ORF particles, GNAI1 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein alpha inhibitor 1 (GNAI1) (NM_001256414) Human Tagged ORF Clone
RC232421

USD 420.00

3 Weeks

GNAI1 (Myc-DDK tagged) - Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Tagged ORF Clone
RG205289

USD 460.00

3 Weeks

GNAI1 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha inhibitor 1 (GNAI1) (NM_001256414) Human Tagged ORF Clone
RG232421

USD 460.00

3 Weeks

GNAI1 (GFP-tagged) - Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Untagged Clone
SC309030

USD 760.00

In Stock

GNAI1 (untagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Tagged ORF Clone
RC205289L2

USD 620.00

3 Weeks

Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
G protein alpha inhibitor 1 (GNAI1) (NM_001256414) Human Untagged Clone
SC330422

USD 310.00

In Stock

GNAI1 (untagged) - Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
G protein alpha inhibitor 1 (GNAI1) Mouse Monoclonal Antibody [Clone ID: R4.5]
AM12136PU-N

USD 440.00

2 Weeks

G protein alpha inhibitor 1 (GNAI1) mouse monoclonal antibody, clone R4.5, Purified

Applications IHC, WB
Reactivities Bovine, Guinea Pig, Human, Mouse, Rat
G protein alpha inhibitor 1 (GNAI1) (+ GNAI2) Rabbit Polyclonal Antibody
AP09041PU-N

USD 440.00

2 Weeks

G protein alpha inhibitor 1 (GNAI1) (+ GNAI2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Synthetic peptide
G protein alpha inhibitor 1 (GNAI1) Rabbit Polyclonal Antibody
TA335036

USD 375.00

5 Days

Rabbit Polyclonal Anti-GNAI1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAI1 antibody: synthetic peptide directed towards the middle region of human GNAI1. Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH
G protein alpha inhibitor 1 (GNAI1) (+ GNAI2) Rabbit Polyclonal Antibody
AP05163PU-N

USD 360.00

5 Days

G protein alpha inhibitor 1 (GNAI1) (+ GNAI2) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Peptide corresponding to amino acids 345 - 354 of Gialpha1 and 346-355 of Gialpha2.
G protein alpha inhibitor 1 (1-354, His-tag) Human Protein
AR50049PU-S

USD 330.00

2 Weeks

G protein alpha inhibitor 1 (1-354, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Over-expression Lysate
LY419561

USD 396.00

5 Days

Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
G protein alpha inhibitor 1 (1-354, His-tag) Human Protein
AR50049PU-N

USD 845.00

2 Weeks

G protein alpha inhibitor 1 (1-354, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
G protein alpha inhibitor 1 (GNAI1) (NM_002069) ICC Control Block
TB405289

USD 1,070.00

4 Weeks

Transient overexpression of GNAI1 (NM_002069) in HEK293T cells paraffin embedded controls for ICC/IHC staining

G protein alpha inhibitor 1 (GNAI1) (NM_001256414) ICC Control Block
TB432421

USD 1,070.00

4 Weeks

Transient overexpression of GNAI1 (NM_001256414) in HEK293T cells paraffin embedded controls for ICC/IHC staining

G protein alpha inhibitor 1 (GNAI1) Cytosection
TS405289

USD 225.00

4 Weeks

Transient overexpression of GNAI1 (NM_002069) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

G protein alpha inhibitor 1 (GNAI1) Cytosection
TS405289P5

USD 889.00

4 Weeks

Transient overexpression of GNAI1 (NM_002069) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

G protein alpha inhibitor 1 (GNAI1) ICC Control Sections
TS432421P5

USD 889.00

4 Weeks

Transient overexpression of GNAI1 (NM_001256414) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack