Germany
Japan
United Kingdom
China
GNAI1 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Gnai1 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), alpha inhibiting 1 (Gnai1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 823.00
In Stock
Recombinant protein of human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, GNAI1 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, GNAI1 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Gnai1 (GFP-tagged) - Mouse guanine nucleotide binding protein (G protein) alpha inhibiting 1 (Gnai1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gnai1 (Myc-DDK-tagged ORF) - Rat guanine nucleotide binding protein (G protein), alpha inhibiting 1 (Gnai1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GNAI1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN405289 is the updated version of KN205289.
Gnai1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN507062 is the updated version of KN307062.
Lenti ORF clone of Gnai1 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), alpha inhibiting 1 (Gnai1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gnai1 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), alpha inhibiting 1 (Gnai1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gnai1 (mGFP-tagged) - Mouse guanine nucleotide binding protein (G protein), alpha inhibiting 1 (Gnai1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gnai1 (GFP-tagged) - Mouse guanine nucleotide binding protein (G protein), alpha inhibiting 1 (Gnai1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, GNAI1 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, GNAI1 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 420.00
3 Weeks
GNAI1 (Myc-DDK tagged) - Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GNAI1 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
3 Weeks
GNAI1 (GFP-tagged) - Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Gnai1 (Myc-DDK-tagged ORF) - Rat guanine nucleotide binding protein (G protein), alpha inhibiting 1 (Gnai1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gnai1 (Myc-DDK-tagged ORF) - Rat guanine nucleotide binding protein (G protein), alpha inhibiting 1 (Gnai1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gnai1 (mGFP-tagged ORF) - Rat guanine nucleotide binding protein (G protein), alpha inhibiting 1 (Gnai1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gnai1 (GFP-tagged ORF) - Rat guanine nucleotide binding protein (G protein), alpha inhibiting 1 (Gnai1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GNAI1 (untagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Gnai1 (untagged) - Mouse guanine nucleotide binding protein (G protein), alpha inhibiting 1 (Gnai1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Gnai1 (untagged ORF) - Rat guanine nucleotide binding protein (G protein), alpha inhibiting 1 (Gnai1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
USD 480.00
2 Weeks
USD 620.00
3 Weeks
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
USD 310.00
In Stock
GNAI1 (untagged) - Homo sapiens guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
USD 440.00
2 Weeks
G protein alpha inhibitor 1 (GNAI1) mouse monoclonal antibody, clone R4.5, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Guinea Pig, Human, Mouse, Rat |
USD 440.00
2 Weeks
Rabbit Polyclonal Anti-GNAI1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAI1 antibody: synthetic peptide directed towards the middle region of human GNAI1. Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH |
USD 815.00
In Stock
GNAI1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
USD 360.00
5 Days
G protein alpha inhibitor 1 (GNAI1) (+ GNAI2) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Peptide corresponding to amino acids 345 - 354 of Gialpha1 and 346-355 of Gialpha2. |
G protein alpha inhibitor 1 (1-354, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
USD 396.00
5 Days
Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Gnai1
G protein alpha inhibitor 1 (1-354, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GNAI1 mouse monoclonal antibody,clone OTI2D1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GNAI1 CRISPRa kit - CRISPR gene activation of human G protein subunit alpha i1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Gnai1 CRISPRa kit - CRISPR gene activation of mouse guanine nucleotide binding protein (G protein), alpha inhibiting 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene GNAI1
USD 121.00
2 Weeks
GNAI1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 2,055.00
3 Weeks
GNAI1 MS Standard C13 and N15-labeled recombinant protein (NP_002060)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
3`UTR clone of guanine nucleotide binding protein (G protein) alpha inhibiting activity polypeptide 1 (GNAI1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Gnai1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Gnai1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
GNAI1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GNAI1 |
GNAI1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-354 of human GNAI1 (NP_002060.4). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GNAI1