Products

Antibodies (42)
cDNA Clones (7)
Proteins (4)
Jump to Filters
View as table Download
IKB epsilon (NFKBIE) (NM_004556) Human Tagged ORF Clone
RC214683

USD 480.00

In Stock

NFKBIE (Myc-DDK-tagged)-Human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon (NFKBIE)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
IKB epsilon (NFKBIE) (NM_004556) Human Tagged ORF Clone
RC214683L3

USD 680.00

3 Weeks

Lenti-ORF clone of NFKBIE (Myc-DDK-tagged)-Human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon (NFKBIE)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IKB epsilon (NFKBIE) (NM_004556) Human Tagged ORF Clone Lentiviral Particle
RC214683L3V

USD 880.00

6 Weeks

Lenti ORF particles, NFKBIE (Myc-DDK-tagged)-Human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon (NFKBIE), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
IKB epsilon (NFKBIE) (NM_004556) Human Tagged ORF Clone
RC214683L4

USD 680.00

In Stock

Lenti-ORF clone of NFKBIE (mGFP-tagged)-Human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon (NFKBIE)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IKB epsilon (NFKBIE) (NM_004556) Human Tagged ORF Clone Lentiviral Particle
RC214683L4V

USD 880.00

2 Weeks

Lenti ORF particles, NFKBIE (mGFP-tagged)-Human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon (NFKBIE), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
IKB epsilon (NFKBIE) (NM_004556) Human Tagged ORF Clone
RG214683

USD 530.00

3 Weeks

NFKBIE (GFP-tagged) - Human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon (NFKBIE)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
IKB epsilon (NFKBIE) (NM_004556) Human Recombinant Protein
TP760703

USD 215.00

In Stock

Purified recombinant protein of Human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon (NFKBIE), with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
IKB epsilon (NFKBIE) (NM_004556) Human Untagged Clone
SC122682

USD 840.00

In Stock

NFKBIE (untagged)-Human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon (NFKBIE)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
IKB epsilon (NFKBIE) Rabbit Polyclonal Antibody
TA314256

USD 345.00

4 Weeks

Rabbit polyclonal IkB-epsilon (Ab-22) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human I?B-e around the phosphorylation site of serine 22 (I-E-SP-L-R).
IKB epsilon (NFKBIE) Rabbit Polyclonal Antibody
TA325734

USD 345.00

In Stock

Rabbit Polyclonal IkappaB-epsilon Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IkappaB-epsilon
IKB epsilon (NFKBIE) Rabbit Polyclonal Antibody
TA325735

USD 345.00

In Stock

Rabbit Polyclonal I kappaB- epsilon (Ser22) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human I kappaB- epsilon around the phosphorylation site of Serine 22
Modifications Phospho-specific
IKB epsilon (NFKBIE) Rabbit Polyclonal Antibody
TA322730

USD 345.00

4 Weeks

Anti-NFKBIE (Phospho-Ser22) Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 22 (I-E-S(p)-L-R) derived from Human IkB-e.
Modifications Phospho-specific
IKB epsilon (NFKBIE) Rabbit Polyclonal Antibody
TA343475

USD 375.00

5 Days

Rabbit Polyclonal Anti-NFKBIE Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFKBIE antibody: synthetic peptide directed towards the middle region of human NFKBIE. Synthetic peptide located within the following region: DARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEES
IKB epsilon (NFKBIE) Mouse Monoclonal Antibody [Clone ID: OTI6H8]
CF810713

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NFKBIE mouse monoclonal antibody,clone OTI6H8

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
IKB epsilon (NFKBIE) Rabbit Polyclonal Antibody
TA322728

USD 345.00

In Stock

Anti-NFKBIE Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 63-423 amino acids of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon
IKB epsilon (NFKBIE) Rabbit Polyclonal Antibody
TA322729

USD 345.00

In Stock

Anti-NFKBIE Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 63-423 amino acids of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon