Products

cDNA Clones (27)
Proteins (10)
Antibodies (3)
Jump to Filters
View as table Download
TAF6 (NM_139315) Human Tagged ORF Clone
RC201951

USD 420.00

4 Weeks

TAF6 (Myc-DDK-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TAF6 (NM_139315) Human Tagged ORF Clone
RC201951L3

USD 620.00

4 Weeks

Lenti-ORF clone of TAF6 (Myc-DDK-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_139315) Human Tagged ORF Clone Lentiviral Particle
RC201951L3V

USD 820.00

7 Weeks

Lenti ORF particles, TAF6 (Myc-DDK-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_139315) Human Tagged ORF Clone
RC201951L4

USD 620.00

4 Weeks

Lenti-ORF clone of TAF6 (mGFP-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_139315) Human Tagged ORF Clone Lentiviral Particle
RC201951L4V

USD 820.00

7 Weeks

Lenti ORF particles, TAF6 (mGFP-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_005641) Human Tagged ORF Clone
RC213036

USD 420.00

4 Weeks

TAF6 (Myc-DDK-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TAF6 (NM_005641) Human Tagged ORF Clone
RC213036L3

USD 620.00

4 Weeks

Lenti-ORF clone of TAF6 (Myc-DDK-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_005641) Human Tagged ORF Clone Lentiviral Particle
RC213036L3V

USD 820.00

7 Weeks

Lenti ORF particles, TAF6 (Myc-DDK-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_005641) Human Tagged ORF Clone
RC213036L4

USD 620.00

4 Weeks

Lenti-ORF clone of TAF6 (mGFP-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_005641) Human Tagged ORF Clone Lentiviral Particle
RC213036L4V

USD 820.00

7 Weeks

Lenti ORF particles, TAF6 (mGFP-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_139123) Human Tagged ORF Clone
RC224515

USD 700.00

4 Weeks

TAF6 (Myc-DDK-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TAF6 (NM_139123) Human Tagged ORF Clone
RC224515L3

USD 900.00

4 Weeks

Lenti-ORF clone of TAF6 (Myc-DDK-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_139123) Human Tagged ORF Clone Lentiviral Particle
RC224515L3V

USD 1,100.00

7 Weeks

Lenti ORF particles, TAF6 (Myc-DDK-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_139123) Human Tagged ORF Clone
RC224515L4

USD 900.00

4 Weeks

Lenti-ORF clone of TAF6 (mGFP-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_139123) Human Tagged ORF Clone Lentiviral Particle
RC224515L4V

USD 1,100.00

7 Weeks

Lenti ORF particles, TAF6 (mGFP-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_001190415) Human Tagged ORF Clone
RC231390

USD 790.00

4 Weeks

TAF6 (Myc-DDK-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
TAF6 (NM_001190415) Human Tagged ORF Clone
RC231390L3

USD 990.00

4 Weeks

Lenti-ORF clone of TAF6 (Myc-DDK-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_001190415) Human Tagged ORF Clone Lentiviral Particle
RC231390L3V

USD 1,190.00

7 Weeks

Lenti ORF particles, TAF6 (Myc-DDK-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_001190415) Human Tagged ORF Clone
RC231390L4

USD 990.00

4 Weeks

Lenti-ORF clone of TAF6 (mGFP-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_001190415) Human Tagged ORF Clone Lentiviral Particle
RC231390L4V

USD 1,190.00

7 Weeks

Lenti ORF particles, TAF6 (mGFP-tagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF6 (NM_139315) Human Tagged ORF Clone
RG201951

USD 460.00

5 Weeks

TAF6 (GFP-tagged) - Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TAF6 (NM_005641) Human Tagged ORF Clone
RG213036

USD 460.00

5 Weeks

TAF6 (GFP-tagged) - Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TAF6 (NM_139123) Human Tagged ORF Clone
RG224515

USD 770.00

3 Weeks

TAF6 (GFP-tagged) - Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TAF6 (NM_001190415) Human Tagged ORF Clone
RG231390

USD 870.00

5 Weeks

TAF6 (GFP-tagged) - Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TAF6 (NM_005641) Human Untagged Clone
SC111695

USD 310.00

In Stock

TAF6 (untagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TAF6 Rabbit Polyclonal Antibody
TA337292

USD 310.00

5 Days

Rabbit Polyclonal Anti-TAF6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF6 antibody: synthetic peptide directed towards the N terminal of human TAF6. Synthetic peptide located within the following region: LTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHA
TAF6 Rabbit Polyclonal Antibody
TA343551

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAF6 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF6 antibody: synthetic peptide directed towards the C terminal of human TAF6. Synthetic peptide located within the following region: PSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHP
TAF6 Rabbit Polyclonal Antibody
TA343550

USD 310.00

5 Days

Rabbit Polyclonal Anti-TAF6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF6 antibody: synthetic peptide directed towards the N terminal of human TAF6. Synthetic peptide located within the following region: TVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMG
TAF6 (NM_005641) Human Over-expression Lysate
LC417172

USD 121.00

2 Weeks

TAF6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TAF6 (NM_005641) Human Over-expression Lysate
LY417172

USD 396.00

5 Days

Transient overexpression lysate of TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

TAF6 (NM_139315) Human Untagged Clone
SC124621

USD 760.00

5 Weeks

TAF6 (untagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TAF6 (NM_139123) Human Untagged Clone
SC314369

USD 1,360.00

4 Weeks

TAF6 (untagged)-Human TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa (TAF6), transcript variant 4

Vector pCMV6 series
Tag Tag Free
TAF6 ICC Control Block
TB401951

USD 1,070.00

4 Weeks

Transient overexpression of TAF6 (NM_139315) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TAF6 ICC Control Block
TB413036

USD 1,070.00

4 Weeks

Transient overexpression of TAF6 (NM_005641) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TAF6 ICC Control Block
TB424515

USD 1,350.00

4 Weeks

Transient overexpression of TAF6 (NM_139123) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TAF6 ICC Control Block
TB431390

USD 1,440.00

4 Weeks

Transient overexpression of TAF6 (NM_001190415) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TAF6 ICC Control Sections
TS401951P5

USD 889.00

4 Weeks

Transient overexpression of TAF6 (NM_139315) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

TAF6 ICC Control Sections
TS413036P5

USD 889.00

4 Weeks

Transient overexpression of TAF6 (NM_005641) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

TAF6 ICC Control Sections
TS424515P5

USD 889.00

4 Weeks

Transient overexpression of TAF6 (NM_139123) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

TAF6 ICC Control Sections
TS431390P5

USD 889.00

4 Weeks

Transient overexpression of TAF6 (NM_001190415) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack