Products

cDNA Clones (27)

Antibodies (23)

Proteins (23)

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 73 results

Page 1 of 2

(reset)

MMP2 (NM_004530) Human Tagged ORF Clone

RC200720

USD 420.00

In Stock

MMP2 (Myc-DDK-tagged)-Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• 

1 / 2

2 / 2

Previous Next

MMP2 (NM_004530) Human Untagged Clone

SC321560

USD 310.00

In Stock

MMP2 (untagged)-Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1

Vector	pCMV6-AC
Tag	Tag Free
Mammalian Cell Selection	Neomycin

SC321560 is the updated version of SC125407.

MMP2 (NM_004530) Human Recombinant Protein

TP300720

USD 439.00

In Stock

Recombinant protein of human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1

Tag	C-Myc/DDK
Expression Host	HEK293T

• 

MMP2 (NM_004530) Human Tagged ORF Clone Lentiviral Particle

RC200720L2V

USD 820.00

3 Weeks

Lenti ORF particles, MMP2 (mGFP-tagged) - Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP
Tag	mGFP

• LentiORF^®
• 

MMP2 (NM_004530) Human Tagged ORF Clone Lentiviral Particle

RC200720L1V

USD 820.00

3 Weeks

Lenti ORF particles, MMP2 (Myc-DDK tagged) - Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK

• LentiORF^®
• 

MMP2 (NM_004530) Human Tagged ORF Clone

RG200720

USD 460.00

In Stock

MMP2 (GFP-tagged) - Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

MMP2 (NM_004530) Human Tagged ORF Clone

RC200720L4

USD 620.00

In Stock

Lenti ORF clone of Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1, mGFP tagged

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®

MMP2 (NM_001127891) Human Tagged ORF Clone

RC226017

USD 570.00

In Stock

MMP2 (Myc-DDK-tagged)-Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 2

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• TrueORF^®

MMP2 (NM_004530) Human Tagged ORF Clone Lentiviral Particle

RC200720L3V

USD 820.00

5 Weeks

Lenti ORF particles, MMP2 (Myc-DDK tagged) - Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

MMP2 (NM_004530) Human Tagged ORF Clone Lentiviral Particle

RC200720L4V

USD 820.00

3 Weeks

Lenti ORF particles, MMP2 (mGFP-tagged) - Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

MMP2 (NM_001127891) Human Tagged ORF Clone

RC226017L3

USD 770.00

3 Weeks

Lenti-ORF clone of MMP2 (Myc-DDK-tagged)-Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 2

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®

MMP2 (NM_001127891) Human Tagged ORF Clone Lentiviral Particle

RC226017L3V

USD 970.00

6 Weeks

Lenti ORF particles, MMP2 (Myc-DDK-tagged)-Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 2, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

MMP2 (NM_001127891) Human Tagged ORF Clone

RC226017L4

USD 770.00

3 Weeks

Lenti-ORF clone of MMP2 (mGFP-tagged)-Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 2

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®

MMP2 (NM_001127891) Human Tagged ORF Clone Lentiviral Particle

RC226017L4V

USD 970.00

6 Weeks

Lenti ORF particles, MMP2 (mGFP-tagged)-Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 2, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

MMP2 (NM_001302508) Human Tagged ORF Clone

RC238982

USD 480.00

3 Weeks

MMP2 (myc-DDK-tagged) - Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 3

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• TrueORF^®

MMP2 (NM_001302509) Human Tagged ORF Clone

RC238983

USD 480.00

3 Weeks

MMP2 (myc-DDK-tagged) - Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 4

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• TrueORF^®

MMP2 (NM_001302510) Human Tagged ORF Clone

RC238984

USD 480.00

3 Weeks

MMP2 (myc-DDK-tagged) - Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 5

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• TrueORF^®

MMP2 (NM_001127891) Human Tagged ORF Clone

RG226017

USD 630.00

3 Weeks

MMP2 (GFP-tagged) - Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 2

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

MMP2 Rabbit Polyclonal Antibody

TA308925

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

MMP2 (NM_004530) Human Over-expression Lysate

LY417923

USD 396.00

In Stock

Transient overexpression lysate of matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

MMP2 Rabbit Polyclonal Antibody

TA326260

USD 345.00

In Stock

Rabbit polyclonal MMP-2 antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human MMP-2.

1 / 2

2 / 2

Previous Next

MMP2 (NM_004530) Human Recombinant Protein

TP723320

USD 240.00

2 Weeks

Purified recombinant protein of Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1.

Tag	Tag Free
Expression Host	E. coli

MMP2 (NM_004530) Human Tagged Lenti ORF Clone

RC200720L1

USD 768.00

In Stock

Lenti ORF clone of Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1, Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK
Mammalian Cell Selection	None

• LentiORF^®

1 / 2

2 / 2

Previous Next

MMP2 (C-term) Rabbit Polyclonal Antibody

AP23331PU-N

USD 405.00

2 Weeks

MMP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminal of human MMP2

1 / 2

2 / 2

Previous Next

MMP2 (NM_004530) Human Over-expression Lysate

LC417923

USD 121.00

In Stock

MMP2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

MMP2 (NM_004530) Human Tagged ORF Clone

RC200720L3

USD 768.00

3 Weeks

Lenti ORF clone of Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1, Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®

MMP2 Rabbit Polyclonal Antibody

TA332987

USD 275.00

3 Weeks

Rabbit anti-MMP2 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human MMP2

MMP2 (NM_004530) Human Tagged ORF Clone

RC200720L2

USD 620.00

In Stock

Lenti ORF clone of Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 1, mGFP tagged

Vector	pLenti-C-mGFP
Tag	mGFP
Mammalian Cell Selection	None

• LentiORF^®

MMP2 Rabbit Polyclonal Antibody

TA347674

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-MMP2 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-MMP2 Antibody: A synthesized peptide derived from human MMP2

MMP2 Rabbit Polyclonal Antibody

TA350972

USD 345.00

In Stock

Rabbit Polyclonal Anti-MMP2 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human MMP2

MMP2 Rabbit Polyclonal Antibody

TA354278

USD 355.00

5 Days

Rabbit anti MMP-2 Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to C-term of human MMP2. This sequence is identical among human, rat, mouse, chicken, dog and bovine.

1 / 2

2 / 2

Previous Next

MMP2 Rabbit Polyclonal Antibody

TA330021

USD 310.00

5 Days

Rabbit Polyclonal Anti-MMP2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-MMP2 antibody: synthetic peptide directed towards the C terminal of human MMP2. Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL

1 / 2

2 / 2

Previous Next

MMP2 Mouse Monoclonal Antibody [Clone ID: 4D3]

TA353336L

USD 1,140.00

9 Weeks

Mouse monoclonal Anti-MMP2 Clone 4D3

Applications	IHC, WB
Conjugation	Unconjugated

1 / 3

2 / 3

3 / 3

Previous Next

MMP2 Mouse Monoclonal Antibody [Clone ID: 8B4]

TA309751

USD 479.00

5 Days

Mouse Monoclonal MMP2 Antibody (8B4)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

MMP2 Mouse Monoclonal Antibody [Clone ID: 2C1]

TA309752

USD 424.00

5 Days

Mouse Monoclonal MMP2 Antibody (2C1)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 3

2 / 3

3 / 3

Previous Next

MMP-2 (110-660, His-tag) Human Protein

AR51367PU-N

USD 1,105.00

2 Weeks

MMP-2 (110-660, His-tag) human protein, 0.25 mg

Tag	His-tag
Expression Host	E. coli

MMP-2 (110-660, His-tag) Human Protein

AR51367PU-S

USD 415.00

2 Weeks

MMP-2 (110-660, His-tag) human protein, 50 µg

Tag	His-tag
Expression Host	E. coli

MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4A11]

CF806846

USD 545.00

3 Days

Carrier-free (BSA/glycerol-free) MMP2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4B11]

CF806847

USD 545.00

3 Days

Carrier-free (BSA/glycerol-free) MMP2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

MMP2 (NM_004530) Human Mass Spec Standard

PH300720

USD 2,055.00

3 Weeks

MMP2 MS Standard C13 and N15-labeled recombinant protein (NP_004521)

Tag	C-Myc/DDK
Expression Host	HEK293

MMP2 (NM_001302508) Human Tagged ORF Clone

RG238982

USD 520.00

2 Weeks

MMP2 (GFP-tagged) - Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 3

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

MMP2 (NM_001302509) Human Tagged ORF Clone

RG238983

USD 520.00

2 Weeks

MMP2 (GFP-tagged) - Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 4

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

MMP2 (NM_001302510) Human Tagged ORF Clone

RG238984

USD 520.00

2 Weeks

MMP2 (GFP-tagged) - Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 5

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

MMP2 (NM_001127891) Human Untagged Clone

SC323153

USD 1,040.00

3 Weeks

MMP2 (untagged)-Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 2

Vector	pCMV6-Entry
Tag	Tag Free
Mammalian Cell Selection	Neomycin

MMP2 (NM_001302508) Human Untagged Clone

SC336876

USD 600.00

3 Weeks

MMP2 (untagged) - Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 3

Vector	pCMV6-Entry
Tag	Tag Free
Mammalian Cell Selection	Neomycin

MMP2 (NM_001302509) Human Untagged Clone

SC336877

USD 600.00

3 Weeks

MMP2 (untagged) - Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 4

Vector	pCMV6-Entry
Tag	Tag Free
Mammalian Cell Selection	Neomycin

MMP2 (NM_001302510) Human Untagged Clone

SC336878

USD 600.00

3 Weeks

MMP2 (untagged) - Human matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (MMP2), transcript variant 5

Vector	pCMV6-Entry
Tag	Tag Free
Mammalian Cell Selection	Neomycin

MMP2 Rabbit Polyclonal Antibody

TA350971

USD 345.00

In Stock

Rabbit Polyclonal Anti-MMP2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human MMP2

MMP2 Rabbit Polyclonal Antibody

TA350973

USD 345.00

In Stock

Rabbit Polyclonal Anti-MMP2 Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human MMP2

MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4A11]

TA806846

USD 379.00

In Stock

MMP2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

1 - 50 of 73 results

Page 1 of 2