Products

Antibodies (57)

cDNA Clones (14)

Proteins (11)

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 82 results

Page 1 of 2

(reset)

ACAT2 (NM_005891) Human Tagged ORF Clone

RC201821

USD 420.00

In Stock

ACAT2 (Myc-DDK-tagged)-Human acetyl-CoA acetyltransferase 2 (ACAT2)

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• 

1 / 2

2 / 2

Previous Next

ACAT2 (NM_005891) Human Recombinant Protein

TP301821

USD 823.00

In Stock

Recombinant protein of human acetyl-Coenzyme A acetyltransferase 2 (ACAT2)

Tag	C-Myc/DDK
Expression Host	HEK293T

• 

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

ACAT2 (NM_005891) Human Tagged ORF Clone Lentiviral Particle

RC201821L1V

USD 820.00

3 Weeks

Lenti ORF particles, ACAT2 (Myc-DDK tagged) - Human acetyl-CoA acetyltransferase 2 (ACAT2), 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK

• LentiORF^®
• 

ACAT2 (NM_005891) Human Tagged ORF Clone Lentiviral Particle

RC201821L2V

USD 820.00

6 Weeks

Lenti ORF particles, ACAT2 (mGFP-tagged) - Human acetyl-CoA acetyltransferase 2 (ACAT2), 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP
Tag	mGFP

• LentiORF^®
• 

ACAT2 (NM_005891) Human Tagged ORF Clone

RG201821

USD 460.00

In Stock

ACAT2 (GFP-tagged) - Human acetyl-CoA acetyltransferase 2 (ACAT2)

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

ACAT2 (NM_005891) Human Tagged ORF Clone

RC201821L3

USD 620.00

3 Weeks

Lenti ORF clone of Human acetyl-CoA acetyltransferase 2 (ACAT2), Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®

ACAT2 (NM_005891) Human Tagged ORF Clone Lentiviral Particle

RC201821L3V

USD 820.00

5 Weeks

Lenti ORF particles, ACAT2 (Myc-DDK tagged) - Human acetyl-CoA acetyltransferase 2 (ACAT2), 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

ACAT2 (NM_005891) Human Tagged ORF Clone

RC201821L4

USD 620.00

3 Weeks

Lenti ORF clone of Human acetyl-CoA acetyltransferase 2 (ACAT2), mGFP tagged

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®

ACAT2 (NM_005891) Human Tagged ORF Clone Lentiviral Particle

RC201821L4V

USD 820.00

7 Weeks

Lenti ORF particles, ACAT2 (mGFP-tagged) - Human acetyl-CoA acetyltransferase 2 (ACAT2), 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

ACAT2 (NM_001303253) Human Tagged ORF Clone

RC238154

USD 420.00

2 Weeks

ACAT2 (myc-DDK-tagged) - Human acetyl-CoA acetyltransferase 2 (ACAT2), transcript variant 2

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• TrueORF^®

ACAT2 (NM_005891) Human Tagged ORF Clone

RC201821L1

USD 768.00

In Stock

Lenti ORF clone of Human acetyl-CoA acetyltransferase 2 (ACAT2), Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK
Mammalian Cell Selection	None

• LentiORF^®

1 / 2

2 / 2

Previous Next

ACAT2 (NM_005891) Human Over-expression Lysate

LY417006

USD 396.00

In Stock

Transient overexpression lysate of acetyl-Coenzyme A acetyltransferase 2 (ACAT2)

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

ACAT2 (NM_005891) Human Untagged Clone

SC320257

USD 310.00

In Stock

ACAT2 (untagged)-Human acetyl-CoA acetyltransferase 2 (ACAT2)

Vector	pCMV6-AC
Tag	Tag Free
Mammalian Cell Selection	Neomycin

ACAT2 Rabbit Polyclonal Antibody

TA331169

USD 310.00

5 Days

Rabbit Polyclonal Anti-ACAT2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

1 / 2

2 / 2

Previous Next

ACAT2 (NM_005891) Human Tagged ORF Clone

RC201821L2

USD 620.00

3 Weeks

Lenti ORF clone of Human acetyl-CoA acetyltransferase 2 (ACAT2), mGFP tagged

Vector	pLenti-C-mGFP
Tag	mGFP
Mammalian Cell Selection	None

• LentiORF^®

ACAT2 (NM_005891) Human Over-expression Lysate

LC417006

USD 121.00

In Stock

ACAT2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

ACAT2 Rabbit Polyclonal Antibody

TA310033

USD 205.00

3 Weeks

Rabbit anti-ACAT2 polyclonal antibody

Applications	WB
Reactivities	Human, Murine, Rat, Porcine, Ovine
Conjugation	Unconjugated
Immunogen	Synthetic peptide derived from Human ACAT 2

ACAT2 / ACTL (1-397, His-tag) Human Protein

AR09571PU-L

USD 845.00

2 Weeks

ACAT2 / ACTL (1-397, His-tag) human recombinant protein, 0.5 mg

Tag	His-tag
Expression Host	E. coli

ACAT2 / ACTL (1-397, His-tag) Human Protein

AR09571PU-N

USD 330.00

2 Weeks

ACAT2 / ACTL (1-397, His-tag) human recombinant protein, 0.1 mg

Tag	His-tag
Expression Host	E. coli

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1C5]

CF501216

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A11]

CF501217

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A8]

CF501218

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5F7]

CF501219

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1G6]

CF501220

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI7B1]

CF501221

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3E2]

CF501222

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3C9]

CF501223

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5C9]

CF501224

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5A2]

CF501225

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1B7]

CF501238

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

ACAT2 (NM_005891) Human Mass Spec Standard

PH301821

USD 2,055.00

3 Weeks

ACAT2 MS Standard C13 and N15-labeled recombinant protein (NP_005882)

Tag	C-Myc/DDK
Expression Host	HEK293

ACAT2 (NM_001303253) Human Tagged ORF Clone

RG238154

USD 460.00

2 Weeks

ACAT2 (GFP-tagged) - Human acetyl-CoA acetyltransferase 2 (ACAT2), transcript variant 2

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

ACAT2 (NM_001303253) Human Untagged Clone

SC336048

USD 420.00

2 Weeks

ACAT2 (untagged) - Human acetyl-CoA acetyltransferase 2 (ACAT2), transcript variant 2

Vector	pCMV6-Entry
Tag	Tag Free
Mammalian Cell Selection	Neomycin

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1C5]

TA501216

USD 379.00

In Stock

ACAT2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C5]

TA501216AM

USD 420.00

4 Weeks

ACAT2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C5]

TA501216BM

USD 420.00

4 Weeks

ACAT2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1C5]

TA501216S

USD 159.00

2 Days

ACAT2 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A11]

TA501217

USD 379.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A11]

TA501217AM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A11]

TA501217BM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A11]

TA501217S

USD 159.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A8]

TA501218

USD 379.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A8]

TA501218AM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8), Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A8]

TA501218BM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A8]

TA501218S

USD 159.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5F7]

TA501219

USD 379.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F7]

TA501219AM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F7]

TA501219BM

USD 420.00

4 Weeks

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5F7]

TA501219S

USD 159.00

2 Days

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1G6]

TA501220

USD 379.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

1 - 50 of 82 results

Page 1 of 2