Products

cDNA Clones (45)
Proteins (31)
Antibodies (11)
Jump to Filters
View as table Download
5HT4 Receptor (HTR4) (NM_199453) Human Tagged ORF Clone
RC218409

USD 420.00

In Stock

HTR4 (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant g

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
5HT4 Receptor (HTR4) (NM_001040171) Human Tagged ORF Clone
RC217913

USD 420.00

In Stock

HTR4 (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant d

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
5HT4 Receptor (HTR4) (NM_000870) Human Tagged ORF Clone
RC210367

USD 420.00

In Stock

HTR4 (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant b

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
5HT4 Receptor (HTR4) (NM_000870) Human Tagged ORF Clone
RG210367

USD 460.00

In Stock

HTR4 (GFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant b

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
5HT4 Receptor (HTR4) (NM_001040169) Human Tagged ORF Clone
RG211606

USD 460.00

In Stock

HTR4 (GFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant a

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
5HT4 Receptor (HTR4) (NM_001040171) Human Tagged ORF Clone
RG217913

USD 460.00

In Stock

HTR4 (GFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant d

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
5HT4 Receptor (HTR4) (NM_001040169) Human Tagged ORF Clone
RC211606

USD 420.00

In Stock

HTR4 (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant a

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
5HT4 Receptor (HTR4) (NM_001040172) Human Tagged ORF Clone
RC211874

USD 420.00

In Stock

HTR4 (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant d

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
5HT4 Receptor (HTR4) (NM_001040173) Human Tagged ORF Clone
RC224437

USD 420.00

In Stock

HTR4 (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant i

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
5HT4 Receptor (HTR4) (NM_000870) Human Tagged ORF Clone
RC210367L3

USD 620.00

3 Weeks

Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant b, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_000870) Human Tagged ORF Clone Lentiviral Particle
RC210367L3V

USD 820.00

6 Weeks

Lenti ORF particles, HTR4 (Myc-DDK tagged) - Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_000870) Human Tagged ORF Clone
RC210367L4

USD 620.00

3 Weeks

Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant b, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_000870) Human Tagged ORF Clone Lentiviral Particle
RC210367L4V

USD 820.00

6 Weeks

Lenti ORF particles, HTR4 (mGFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040169) Human Tagged ORF Clone
RC211606L3

USD 620.00

3 Weeks

Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant a, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040169) Human Tagged ORF Clone Lentiviral Particle
RC211606L3V

USD 820.00

6 Weeks

Lenti ORF particles, HTR4 (Myc-DDK tagged) - Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040169) Human Tagged ORF Clone
RC211606L4

USD 620.00

3 Weeks

Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant a, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040169) Human Tagged ORF Clone Lentiviral Particle
RC211606L4V

USD 820.00

6 Weeks

Lenti ORF particles, HTR4 (mGFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040172) Human Tagged ORF Clone
RC211874L3

USD 620.00

3 Weeks

Lenti-ORF clone of HTR4 (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant d

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040172) Human Tagged ORF Clone Lentiviral Particle
RC211874L3V

USD 820.00

6 Weeks

Lenti ORF particles, HTR4 (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant d, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040172) Human Tagged ORF Clone
RC211874L4

USD 620.00

3 Weeks

Lenti-ORF clone of HTR4 (mGFP-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant d

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040172) Human Tagged ORF Clone Lentiviral Particle
RC211874L4V

USD 820.00

6 Weeks

Lenti ORF particles, HTR4 (mGFP-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant d, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040171) Human Tagged ORF Clone
RC217913L3

USD 620.00

3 Weeks

Lenti-ORF clone of HTR4 (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant d

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040171) Human Tagged ORF Clone Lentiviral Particle
RC217913L3V

USD 820.00

6 Weeks

Lenti ORF particles, HTR4 (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant d, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040171) Human Tagged ORF Clone
RC217913L4

USD 620.00

3 Weeks

Lenti-ORF clone of HTR4 (mGFP-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant d

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040171) Human Tagged ORF Clone Lentiviral Particle
RC217913L4V

USD 820.00

6 Weeks

Lenti ORF particles, HTR4 (mGFP-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant d, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_199453) Human Tagged ORF Clone
RC218409L3

USD 620.00

3 Weeks

Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant g, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_199453) Human Tagged ORF Clone Lentiviral Particle
RC218409L3V

USD 820.00

6 Weeks

Lenti ORF particles, HTR4 (Myc-DDK tagged) - Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant g, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_199453) Human Tagged ORF Clone
RC218409L4

USD 620.00

3 Weeks

Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant g, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_199453) Human Tagged ORF Clone Lentiviral Particle
RC218409L4V

USD 820.00

6 Weeks

Lenti ORF particles, HTR4 (mGFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant g, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040173) Human Tagged ORF Clone
RC224437L3

USD 620.00

3 Weeks

Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant i, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040173) Human Tagged ORF Clone Lentiviral Particle
RC224437L3V

USD 820.00

6 Weeks

Lenti ORF particles, HTR4 (Myc-DDK tagged) - Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant i, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040173) Human Tagged ORF Clone
RC224437L4

USD 620.00

3 Weeks

Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant i, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001040173) Human Tagged ORF Clone Lentiviral Particle
RC224437L4V

USD 820.00

6 Weeks

Lenti ORF particles, HTR4 (mGFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant i, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
5HT4 Receptor (HTR4) (NM_001286410) Human Tagged ORF Clone
RC238051

USD 420.00

2 Weeks

HTR4 (myc-DDK-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled (HTR4), transcript variant c

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
5HT4 Receptor (HTR4) (NM_001040172) Human Tagged ORF Clone
RG211874

USD 460.00

3 Weeks

HTR4 (GFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant d

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
5HT4 Receptor (HTR4) (NM_199453) Human Tagged ORF Clone
RG218409

USD 460.00

3 Weeks

HTR4 (GFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant g

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
5HT4 Receptor (HTR4) (NM_001040173) Human Tagged ORF Clone
RG224437

USD 460.00

3 Weeks

HTR4 (GFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant i

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
5HT4 Receptor (HTR4) (NM_000870) Human Over-expression Lysate
LY400307

USD 396.00

In Stock

Transient overexpression lysate of 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant b

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
5HT4 Receptor (HTR4) (NM_199453) Human Untagged Clone
SC307982

USD 650.00

In Stock

HTR4 (untagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant g

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
5HT4 Receptor (HTR4) (NM_000870) Human Untagged Clone
SC310455

USD 760.00

In Stock

HTR4 (untagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant b

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
5HT4 Receptor (HTR4) (NM_001040171) Human Untagged Clone
SC311001

USD 680.00

In Stock

HTR4 (untagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant d

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
5HT4 Receptor (HTR4) (NM_001040172) Human Untagged Clone
SC311002

USD 610.00

In Stock

HTR4 (untagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant d

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
5HT4 Receptor (HTR4) Rabbit Polyclonal Antibody
TA314043

USD 345.00

In Stock

Rabbit polyclonal anti-HTR4 antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HTR4.
5HT4 Receptor (HTR4) Rabbit Polyclonal Antibody
AP20472PU-N

USD 407.00

2 Weeks

5HT4 Receptor (HTR4) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
5HT4 Receptor (HTR4) (NM_001040169) Human Untagged Clone
SC311000

USD 660.00

In Stock

HTR4 (untagged)-Human 5-hydroxytryptamine (serotonin) receptor 4 (HTR4), transcript variant a

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
5HT4 Receptor (HTR4) Rabbit Polyclonal Antibody
TA314044

USD 345.00

4 Weeks

Rabbit polyclonal anti-5-HT-4 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-4.
5HT4 Receptor (HTR4) (NM_000870) Human Over-expression Lysate
LC400307

USD 121.00

In Stock

HTR4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
5HT4 Receptor (HTR4) Rabbit Polyclonal Antibody
TA309697

USD 402.00

5 Days

Rabbit Polyclonal 5HT4 Receptor Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an C-terminal portion of the human 5HT4 Receptor protein (between residues 350-400) [UniProt Q13639]
5HT4 Receptor (HTR4) (N-term) Rabbit Polyclonal Antibody
AP52130PU-N

USD 450.00

2 Weeks

5HT4 Receptor (HTR4) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human Serotonin receptor 4 (HTR4).
5HT4 Receptor (HTR4) Rabbit Polyclonal Antibody
TA330423

USD 375.00

5 Days

Rabbit Polyclonal Anti-HTR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR4 antibody: synthetic peptide directed towards the middle region of human HTR4. Synthetic peptide located within the following region: GCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYA