Germany
Japan
United Kingdom
China
P2RX4 (untagged)-Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC122124 is the updated version of SC121945.
Products
View as table DownloadP2RX4 (Myc-DDK-tagged)-Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, P2RX4 (Myc-DDK tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, P2RX4 (mGFP-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
P2RX4 (GFP-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, P2RX4 (Myc-DDK tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, P2RX4 (mGFP-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
P2RX4 (Myc-DDK tagged) - Homo sapiens purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
P2RX4 (Myc-DDK tagged) - Homo sapiens purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
P2RX4 (myc-DDK-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
P2RX4 (GFP-tagged) - Homo sapiens purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
P2RX4 (GFP-tagged) - Homo sapiens purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
P2RX4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
P2RX4 (untagged)-Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Goat Polyclonal Antibody against P2RX4
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YREKKYKYVEDYEQ, from the C Terminus of the protein sequence according to NP_002551.2. |
Rabbit Polyclonal Anti-P2RX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX4 antibody: synthetic peptide directed towards the N terminal of human P2RX4. Synthetic peptide located within the following region: VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW |
P2RX4 MS Standard C13 and N15-labeled recombinant protein (NP_002551)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
P2RX4 (GFP-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 6
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
P2RX4 (untagged) - Homo sapiens purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
P2RX4 (untagged) - Homo sapiens purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 5
| Vector | pCMV6 series |
| Tag | Tag Free |
P2RX4 (untagged) - Human purinergic receptor P2X, ligand-gated ion channel, 4 (P2RX4), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of P2RX4 (NM_002560) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of P2RX4 (NM_001261397) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of P2RX4 (NM_001256796) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of P2RX4 (NM_001261398) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of P2RX4 (NM_002560) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of P2RX4 (NM_002560) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of P2RX4 (NM_001261397) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of P2RX4 (NM_001256796) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of P2RX4 (NM_001261398) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- P2RX4
Pathways
- Calcium signaling pathway