Germany
Japan
United Kingdom
China
RAD21 (Myc-DDK-tagged)-Human RAD21 homolog (S. pombe) (RAD21)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, RAD21 (Myc-DDK tagged) - Human RAD21 homolog (S. pombe) (RAD21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, RAD21 (mGFP-tagged) - Human RAD21 homolog (S. pombe) (RAD21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
RAD21 (GFP-tagged) - Human RAD21 homolog (S. pombe) (RAD21)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human RAD21 homolog (S. pombe) (RAD21), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RAD21 (Myc-DDK tagged) - Human RAD21 homolog (S. pombe) (RAD21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human RAD21 homolog (S. pombe) (RAD21), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RAD21 (mGFP-tagged) - Human RAD21 homolog (S. pombe) (RAD21), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human RAD21 homolog (S. pombe) (RAD21), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
RAD21 (untagged)-Human RAD21 homolog (S. pombe) (RAD21)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human RAD21 homolog (S. pombe) (RAD21), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
RAD21 (untagged)-Human RAD21 homolog (S. pombe) (RAD21)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-RAD21 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFEN |
Rabbit Polyclonal Anti-RAD21 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: EDDDMLVSTSASNLLLEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGG |
Rabbit polyclonal anti-RAD21 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAD21. |
RAD21 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of RAD21 homolog (S. pombe) (RAD21)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Carrier-free (BSA/glycerol-free) RAD21 mouse monoclonal antibody,clone OTI11F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAD21 mouse monoclonal antibody,clone OTI11F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
RAD21 mouse monoclonal antibody,clone OTI11F10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RAD21 mouse monoclonal antibody,clone OTI11F10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RAD21 mouse monoclonal antibody,clone OTI11F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of RAD21 (NM_006265) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAD21 (NM_006265) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RAD21 (NM_006265) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- RAD21
Pathways
- Cell cycle