GNB1 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GNB1 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GNB1 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GNB1 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GNB1 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GNB1 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GNB1 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GNB1 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GNB1 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-GNB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNB1 |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
GNB1 (untagged)-Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GNB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNB1 antibody: synthetic peptide directed towards the N terminal of human GNB1. Synthetic peptide located within the following region: MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT |
GNB1 (untagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
Rabbit Polyclonal Anti-GNB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNB1 antibody: synthetic peptide directed towards the C terminal of human GNB1. Synthetic peptide located within the following region: DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKAD |
Transducin beta chain 1 / GNB1 (1-340, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
Transducin beta chain 1 / GNB1 (1-340, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
GNB1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GNB1 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GNB1 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
(untagged)-Human cDNA FLJ39295 fis, clone OCBBF2012714, highly similar to GUANINE NUCLEOTIDE-BINDING PROTEIN G(I)/G(S)/G(T) BETA SUBUNIT 1
Vector | pCMV6 series |
Tag | Tag Free |
GNB1 (untagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of GNB1 (NM_002074) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNB1 (NM_001282538) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNB1 (NM_001282539) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNB1 (NM_002074) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GNB1 (NM_002074) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GNB1 (NM_001282538) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GNB1 (NM_001282539) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GNB1 (NM_001282539) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack