Products

cDNA Clones (44)
Proteins (12)
RNAi (12)
Gene Expression (8)
Antibodies (5)
Jump to Filters
View as table Download
GNB1 (NM_002074) Human Tagged ORF Clone
RC200907

USD 420.00

In Stock

GNB1 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Gnb1 (NM_001160017) Mouse Tagged ORF Clone
MR205102

USD 300.00

In Stock

Gnb1 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GNB1 (NM_002074) Human Tagged ORF Clone Lentiviral Particle
RC200907L1V

USD 820.00

3 Weeks

Lenti ORF particles, GNB1 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GNB1 (NM_002074) Human Tagged ORF Clone Lentiviral Particle
RC200907L2V

USD 820.00

6 Weeks

Lenti ORF particles, GNB1 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Gnb1 (NM_008142) Mouse Tagged ORF Clone
MG225895

USD 330.00

In Stock

Gnb1 (GFP-tagged) - Mouse guanine nucleotide binding protein (G protein) beta 1 (Gnb1) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GNB1 (NM_002074) Human Tagged ORF Clone
RG200907

USD 460.00

In Stock

GNB1 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gnb1 (NM_030987) Rat Tagged ORF Clone
RR211747

USD 420.00

In Stock

Gnb1 (Myc-DDK-tagged ORF) - Rat guanine nucleotide binding protein (G protein), beta polypeptide 1 (Gnb1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GNB1 (NM_001282539) Human Tagged ORF Clone
RC237570

USD 420.00

In Stock

GNB1 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GNB1 Human Gene Knockout Kit (CRISPR)
KN400907

USD 1,290.00

2 Weeks

GNB1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN400907 is the updated version of KN200907.
Gnb1 Mouse Gene Knockout Kit (CRISPR)
KN507073

USD 1,290.00

2 Weeks

Gnb1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN507073 is the updated version of KN307073.
Gnb1 (BC013058) Mouse Tagged ORF Clone
MG205102

USD 330.00

3 Weeks

Gnb1 (GFP-tagged) - Mouse guanine nucleotide binding protein, beta 1 (cDNA clone MGC:11501 IMAGE:3964965)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gnb1 (NM_001160016) Mouse Tagged ORF Clone
MG225896

USD 330.00

3 Weeks

Gnb1 (GFP-tagged) - Mouse guanine nucleotide binding protein (G protein) beta 1 (Gnb1) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gnb1 (NM_001160017) Mouse Tagged ORF Clone
MR205102L3

USD 500.00

3 Weeks

Lenti ORF clone of Gnb1 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gnb1 (NM_001160017) Mouse Tagged ORF Clone Lentiviral Particle
MR205102L3V

USD 700.00

6 Weeks

Lenti ORF particles, Gnb1 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gnb1 (NM_001160017) Mouse Tagged ORF Clone
MR205102L4

USD 500.00

3 Weeks

Lenti ORF clone of Gnb1 (mGFP-tagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gnb1 (NM_001160017) Mouse Tagged ORF Clone Lentiviral Particle
MR205102L4V

USD 700.00

6 Weeks

Lenti ORF particles, Gnb1 (GFP-tagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gnb1 (NM_008142) Mouse Tagged ORF Clone
MR225895

USD 300.00

3 Weeks

Gnb1 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gnb1 (NM_008142) Mouse Tagged ORF Clone
MR225895L3

USD 500.00

3 Weeks

Lenti ORF clone of Gnb1 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gnb1 (NM_008142) Mouse Tagged ORF Clone Lentiviral Particle
MR225895L3V

USD 700.00

6 Weeks

Lenti ORF particles, Gnb1 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gnb1 (NM_008142) Mouse Tagged ORF Clone
MR225895L4

USD 500.00

3 Weeks

Lenti ORF clone of Gnb1 (mGFP-tagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gnb1 (NM_008142) Mouse Tagged ORF Clone Lentiviral Particle
MR225895L4V

USD 700.00

6 Weeks

Lenti ORF particles, Gnb1 (GFP-tagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gnb1 (NM_001160016) Mouse Tagged ORF Clone
MR225896

USD 300.00

3 Weeks

Gnb1 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gnb1 (NM_001160016) Mouse Tagged ORF Clone
MR225896L3

USD 500.00

3 Weeks

Lenti ORF clone of Gnb1 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gnb1 (NM_001160016) Mouse Tagged ORF Clone Lentiviral Particle
MR225896L3V

USD 700.00

6 Weeks

Lenti ORF particles, Gnb1 (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gnb1 (NM_001160016) Mouse Tagged ORF Clone
MR225896L4

USD 500.00

3 Weeks

Lenti ORF clone of Gnb1 (mGFP-tagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gnb1 (NM_001160016) Mouse Tagged ORF Clone Lentiviral Particle
MR225896L4V

USD 700.00

6 Weeks

Lenti ORF particles, Gnb1 (GFP-tagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GNB1 (NM_002074) Human Tagged ORF Clone
RC200907L3

USD 620.00

3 Weeks

Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GNB1 (NM_002074) Human Tagged ORF Clone Lentiviral Particle
RC200907L3V

USD 820.00

5 Weeks

Lenti ORF particles, GNB1 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GNB1 (NM_002074) Human Tagged ORF Clone
RC200907L4

USD 620.00

3 Weeks

Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GNB1 (NM_002074) Human Tagged ORF Clone Lentiviral Particle
RC200907L4V

USD 820.00

7 Weeks

Lenti ORF particles, GNB1 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GNB1 (NM_001282538) Human Tagged ORF Clone
RC236839

USD 420.00

2 Weeks

GNB1 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gnb1 (NM_030987) Rat Tagged ORF Clone
RR211747L3

USD 640.00

4 Weeks

Lenti ORF clone of Gnb1 (Myc-DDK-tagged ORF) - Rat guanine nucleotide binding protein (G protein), beta polypeptide 1 (Gnb1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gnb1 (NM_030987) Rat Tagged ORF Clone Lentiviral Particle
RR211747L3V

USD 850.00

8 Weeks

Lenti ORF particles, Gnb1 (Myc-DDK-tagged ORF) - Rat guanine nucleotide binding protein (G protein), beta polypeptide 1 (Gnb1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gnb1 (NM_030987) Rat Tagged ORF Clone
RR211747L4

USD 700.00

4 Weeks

Lenti ORF clone of Gnb1 (mGFP-tagged ORF) - Rat guanine nucleotide binding protein (G protein), beta polypeptide 1 (Gnb1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gnb1 (NM_030987) Rat Tagged ORF Clone Lentiviral Particle
RR211747L4V

USD 960.00

8 Weeks

Lenti ORF particles, Gnb1 (GFP-tagged ORF) - Rat guanine nucleotide binding protein (G protein), beta polypeptide 1 (Gnb1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GNB1 Rabbit Polyclonal Antibody
TA349322

USD 380.00

In Stock

Rabbit Polyclonal Anti-GNB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GNB1
GNB1 (NM_002074) Human Tagged Lenti ORF Clone
RC200907L1

USD 768.00

In Stock

Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GNB1 (NM_002074) Human Untagged Clone
SC118812

USD 310.00

In Stock

GNB1 (untagged)-Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Gnb1 Rat siRNA Oligo Duplex (Locus ID 24400)
SR511459

USD 430.00

In Stock

Gnb1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Gnb1 (NM_008142) Mouse Untagged Clone
MC203766

USD 210.00

In Stock

Gnb1 (untagged) - Mouse guanine nucleotide binding protein (G protein), beta 1 (Gnb1), transcript variant 1, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
GNB1 (NM_002074) Human Tagged ORF Clone
RC200907L2

USD 620.00

3 Weeks

Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GNB1 Rabbit Polyclonal Antibody
TA335041

USD 375.00

5 Days

Rabbit Polyclonal Anti-GNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNB1 antibody: synthetic peptide directed towards the N terminal of human GNB1. Synthetic peptide located within the following region: MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT
GNB1 (NM_001282539) Human Untagged Clone
SC335464

USD 350.00

2 Weeks

GNB1 (untagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 1 (GNB1), transcript variant 2

Vector pCMV6 series
Tag Tag Free
GNB1 Rabbit Polyclonal Antibody
TA335042

USD 375.00

5 Days

Rabbit Polyclonal Anti-GNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNB1 antibody: synthetic peptide directed towards the C terminal of human GNB1. Synthetic peptide located within the following region: DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKAD
Transducin beta chain 1 / GNB1 (1-340, His-tag) Human Protein
AR51485PU-N

USD 1,105.00

2 Weeks

Transducin beta chain 1 / GNB1 (1-340, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
Transducin beta chain 1 / GNB1 (1-340, His-tag) Human Protein
AR51485PU-S

USD 415.00

2 Weeks

Transducin beta chain 1 / GNB1 (1-340, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Human GNB1 activation kit by CRISPRa
GA101854

USD 1,290.00

2 Weeks

GNB1 CRISPRa kit - CRISPR gene activation of human G protein subunit beta 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Gnb1 activation kit by CRISPRa
GA201658

USD 1,290.00

2 Weeks

Gnb1 CRISPRa kit - CRISPR gene activation of mouse guanine nucleotide binding protein (G protein), beta 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
GNB1 Human qPCR Template Standard (NM_002074)
HK203409

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene GNB1

Application Plasmid of exact quantity for transcript copy number calculation
GNB1 Human qPCR Primer Pair (NM_002074)
HP205820

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene GNB1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)