Germany
Japan
United Kingdom
China
ACO1 (Myc-DDK-tagged)-Human aconitase 1, soluble (ACO1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human aconitase 1, soluble (ACO1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 1,150.00
3 Weeks
Lenti ORF particles, ACO1 (Myc-DDK tagged) - Human aconitase 1, soluble (ACO1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 1,150.00
6 Weeks
Lenti ORF particles, ACO1 (mGFP-tagged) - Human aconitase 1, soluble (ACO1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ACO1 (GFP-tagged) - Human aconitase 1, soluble (ACO1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 1,150.00
5 Weeks
Lenti ORF particles, ACO1 (Myc-DDK tagged) - Human aconitase 1, soluble (ACO1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,150.00
3 Weeks
Lenti ORF particles, ACO1 (mGFP-tagged) - Human aconitase 1, soluble (ACO1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ACO1 (myc-DDK-tagged) - Human aconitase 1, soluble (ACO1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-ACO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC |
ACO1 (untagged)-Human aconitase 1, soluble (ACO1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of aconitase 1, soluble (ACO1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human aconitase 1, soluble (ACO1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human aconitase 1, soluble (ACO1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ACO1 (untagged)-Human aconitase 1, soluble (ACO1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Goat Anti-ACO1 / Aconitase 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QVDFNRRADSLQKNQ, from the internal region of the protein sequence according to NP_002188.1. |
Aconitase 1 (ACO1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Aconitase 1 (ACO1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
ACO1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit polyclonal IREB1 / ACO1 (Ser711) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IREB1 around the phosphorylation site of serine 711 (Y-G-SP-R-R). |
| Modifications | Phospho-specific |
ACO1 / IREB1 (1-889, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
ACO1 / IREB1 (1-889, His-tag) human recombinant protein, 10 µg
| Tag | His-tag |
| Expression Host | E. coli |
ACO1 MS Standard C13 and N15-labeled recombinant protein (NP_002188)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ACO1 (GFP-tagged) - Human aconitase 1, soluble (ACO1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACO1 (untagged) - Human aconitase 1, soluble (ACO1), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
Anti-ACO1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 132-146 amino acids of human aconitase 1, soluble |
Anti-ACO1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 132-146 amino acids of human aconitase 1, soluble |
Transient overexpression of ACO1 (NM_002197) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACO1 (NM_001278352) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACO1 (NM_002197) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACO1 (NM_002197) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ACO1 (NM_001278352) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ACO1
Pathways
- Citrate cycle (TCA cycle)