PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PC (Myc-DDK tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PC (mGFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, PC (Myc-DDK tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PC (mGFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PC (GFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PC (untagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti-ORF clone of PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PC (Myc-DDK-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PC (mGFP-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PC (mGFP-tagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PC (Myc-DDK tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PC (mGFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PC (Myc-DDK tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PC (mGFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PC (GFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PC (GFP-tagged) - Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Pyruvate Carboxylase Antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human Pyruvate Carboxylase protein (within residues 930-1050). [Swiss-Prot P11498] |
Rabbit polyclonal PC antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PC. |
PC HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PCB (PC) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 52-82 amino acids from the N-terminal region of human PC |
PC (untagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Goat Polyclonal Antibody against Pyruvate Carboxylase
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KFKEVKKAYVEANQ, from the internal region of the protein sequence according to NP_000911.2; NP_001035806.1; NP_071504.2. |
Rabbit Polyclonal Anti-PC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PC antibody: synthetic peptide directed towards the C terminal of human PC. Synthetic peptide located within the following region: SLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPL |
PC HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PC HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PC MS Standard C13 and N15-labeled recombinant protein (NP_000911)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
PC MS Standard C13 and N15-labeled recombinant protein (NP_001035806)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
PC (untagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
PC (untagged)-Human pyruvate carboxylase (PC), nuclear gene encoding mitochondrial protein, transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Anti-PC Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 563-832 amino acids of human pyruvate carboxylase |
Anti-PC Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 563-832 amino acids of human pyruvate carboxylase |
Transient overexpression of PC (NM_022172) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PC (NM_000920) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PC (NM_001040716) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PC (NM_022172) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PC (NM_022172) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack