Products

cDNA Clones (18)
Proteins (11)
Antibodies (10)
Jump to Filters
View as table Download
Fibrinogen beta chain (FGB) (NM_005141) Human Tagged ORF Clone
RC210471

USD 450.00

In Stock

FGB (Myc-DDK-tagged)-Human fibrinogen beta chain (FGB), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Fibrinogen beta chain (FGB) (NM_005141) Human Tagged ORF Clone
RG210471

USD 500.00

In Stock

FGB (GFP-tagged) - Human fibrinogen beta chain (FGB), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Fibrinogen beta chain (FGB) (NM_001184741) Human Tagged ORF Clone
RC230073

USD 420.00

In Stock

FGB (Myc-DDK-tagged)-Human fibrinogen beta chain (FGB), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Fibrinogen beta chain (FGB) (NM_005141) Human Tagged ORF Clone Lentiviral Particle
RC210471L3V

USD 850.00

5 Weeks

Lenti ORF particles, FGB (Myc-DDK tagged) - Human fibrinogen beta chain (FGB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Fibrinogen beta chain (FGB) (NM_005141) Human Tagged ORF Clone Lentiviral Particle
RC210471L4V

USD 850.00

7 Weeks

Lenti ORF particles, FGB (mGFP-tagged) - Human fibrinogen beta chain (FGB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Fibrinogen beta chain (FGB) (NM_001184741) Human Tagged ORF Clone Lentiviral Particle
RC230073L3V

USD 820.00

6 Weeks

Lenti ORF particles, FGB (Myc-DDK tagged) - Human fibrinogen beta chain (FGB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Fibrinogen beta chain (FGB) (NM_001184741) Human Tagged ORF Clone Lentiviral Particle
RC230073L4V

USD 820.00

6 Weeks

Lenti ORF particles, FGB (mGFP-tagged) - Human fibrinogen beta chain (FGB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Fibrinogen beta chain (FGB) (NM_001184741) Human Tagged ORF Clone
RG230073

USD 460.00

3 Weeks

FGB (GFP-tagged) - Human fibrinogen beta chain (FGB), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Fibrinogen beta chain (FGB) Rabbit Polyclonal Antibody
TA327042

USD 275.00

2 Weeks

FGB Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FGB
Fibrinogen beta chain (FGB) Rabbit Polyclonal Antibody
TA324036

USD 345.00

In Stock

Anti-FGB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 290 amino acids of human fibrinogen beta chain
Fibrinogen beta chain (FGB) Rabbit Polyclonal Antibody
TA346396

USD 475.00

5 Days

Rabbit Polyclonal Anti-FGB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FGB antibody is: synthetic peptide directed towards the middle region of Human FGB. Synthetic peptide located within the following region: GNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNK
Fibrinogen beta chain (FGB) (NM_005141) Human Tagged ORF Clone
RC210471L2

USD 650.00

3 Weeks

Lenti ORF clone of Human fibrinogen beta chain (FGB), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Fibrinogen beta chain (FGB) (NM_005141) Human Untagged Clone
SC112673

USD 830.00

In Stock

FGB (untagged)-Human fibrinogen beta chain (FGB), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Fibrinogen beta chain (FGB) (NM_005141) Human Untagged Clone
SC321032

USD 830.00

In Stock

FGB (untagged)-Human fibrinogen beta chain (FGB), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Fibrinogen beta chain (FGB) Rabbit Polyclonal Antibody
TA312912

USD 345.00

In Stock

Rabbit polyclonal anti-Fibrinogen beta chain antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human FIBB.
Fibrinogen beta chain (FGB) (NM_005141) Human Over-expression Lysate
LC417459

USD 121.00

In Stock

FGB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Fibrinogen beta chain (FGB) Goat Polyclonal Antibody
TA327763

USD 375.00

5 Days

FGB Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region (EKHQLYIDETVNSN)
Fibrinogen beta chain (FGB) (NM_005141) Human Recombinant Protein
TP762206

USD 215.00

In Stock

Purified recombinant protein of Human fibrinogen beta chain (FGB), transcript variant 1, Gln31-Cys316, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
Fibrinogen beta chain (FGB) (C-term) Rabbit Polyclonal Antibody
AP17373PU-N

USD 450.00

2 Weeks

Fibrinogen beta chain (FGB) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human FIBB
Fibrinogen beta chain (FGB) (N-term) Rabbit Polyclonal Antibody
AP17374PU-N

USD 450.00

2 Weeks

Fibrinogen beta chain (FGB) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human FIBB
Fibrinogen beta chain (FGB) Goat Polyclonal Antibody
TA327764

USD 375.00

5 Days

FGB Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region (RSKIQKLESDVSAQ)
Fibrinogen beta chain (164-491, His-tag) Human Protein
AR51914PU-N

USD 845.00

2 Weeks

Fibrinogen beta chain (164-491, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Fibrinogen beta chain (164-491, His-tag) Human Protein
AR51914PU-S

USD 330.00

2 Weeks

Fibrinogen beta chain (164-491, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Fibrinogen beta chain (FGB) (NM_005141) Human Over-expression Lysate
LY417459

USD 396.00

5 Days

Transient overexpression lysate of fibrinogen beta chain (FGB)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Fibrinogen beta chain (FGB) Rabbit Polyclonal Antibody
TA349987

USD 345.00

In Stock

Rabbit Polyclonal Anti-FGB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FGB
Fibrinogen beta chain (FGB) ICC Control Block
TB410471

USD 1,100.00

4 Weeks

Transient overexpression of FGB (NM_005141) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Fibrinogen beta chain (FGB) ICC Control Block
TB430073

USD 1,070.00

4 Weeks

Transient overexpression of FGB (NM_001184741) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Fibrinogen beta chain (FGB) Cytosection
TS410471

USD 225.00

4 Weeks

Transient overexpression of FGB (NM_005141) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Fibrinogen beta chain (FGB) Cytosection
TS410471P5

USD 889.00

4 Weeks

Transient overexpression of FGB (NM_005141) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Fibrinogen beta chain (FGB) Cytosection
TS430073

USD 225.00

4 Weeks

Transient overexpression of FGB (NM_001184741) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Fibrinogen beta chain (FGB) Cytosection
TS430073P5

USD 889.00

4 Weeks

Transient overexpression of FGB (NM_001184741) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack