Germany
Japan
United Kingdom
China
MCM5 (Myc-DDK-tagged)-Human minichromosome maintenance complex component 5 (MCM5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, MCM5 (Myc-DDK tagged) - Human minichromosome maintenance complex component 5 (MCM5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, MCM5 (mGFP-tagged) - Human minichromosome maintenance complex component 5 (MCM5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
MCM5 (GFP-tagged) - Human minichromosome maintenance complex component 5 (MCM5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human minichromosome maintenance complex component 5 (MCM5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MCM5 (Myc-DDK tagged) - Human minichromosome maintenance complex component 5 (MCM5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human minichromosome maintenance complex component 5 (MCM5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MCM5 (mGFP-tagged) - Human minichromosome maintenance complex component 5 (MCM5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human minichromosome maintenance complex component 5 (MCM5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
MCM5 (untagged)-Human minichromosome maintenance complex component 5 (MCM5)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MCM5 (untagged)-Human minichromosome maintenance complex component 5 (MCM5)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-MCM5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM5 Antibody: A synthesized peptide derived from human MCM5 |
Lenti ORF clone of Human minichromosome maintenance complex component 5 (MCM5), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MCM5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of minichromosome maintenance complex component 5 (MCM5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Purified recombinant protein of Human minichromosome maintenance complex component 5 (MCM5), full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-MCM5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM5 antibody: synthetic peptide directed towards the N terminal of human MCM5. Synthetic peptide located within the following region: MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG |
Mouse monoclonal Anti-MCM5 Clone A2.5A12.A12.A11
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone A4.8D6.H10.D9
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone 6G8A4F10
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone A2.2C9.C9.C11
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone A2 12A7
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone A2 4B4
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone A2 9B4
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone A2 2C11
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MCM5 Clone A2 10A12
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti MCM5 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of MCM5 (NM_006739) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MCM5 (NM_006739) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MCM5 (NM_006739) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MCM5
Pathways
- DNA replication