Products

cDNA Clones (10)
Proteins (8)
Antibodies (2)
Jump to Filters
View as table Download
ITGA8 (NM_003638) Human Tagged ORF Clone
RC218936

USD 1,190.00

In Stock

ITGA8 (Myc-DDK-tagged)-Human integrin, alpha 8 (ITGA8)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ITGA8 (NM_003638) Human Tagged ORF Clone
RC218936L3

USD 1,390.00

2 Weeks

Lenti ORF clone of Human integrin, alpha 8 (ITGA8), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ITGA8 (NM_003638) Human Tagged ORF Clone
RC218936L4

USD 1,390.00

3 Weeks

Lenti ORF clone of Human integrin, alpha 8 (ITGA8), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ITGA8 (NM_001291494) Human Tagged ORF Clone
RC239915

USD 1,100.00

4 Weeks

ITGA8 (myc-DDK-tagged) - Human integrin, alpha 8 (ITGA8), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ITGA8 (NM_003638) Human Tagged ORF Clone
RG218936

USD 1,310.00

3 Weeks

ITGA8 (GFP-tagged) - Human integrin, alpha 8 (ITGA8)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ITGA8 (C-term) Rabbit Polyclonal Antibody
AP52252PU-N

USD 450.00

2 Weeks

ITGA8 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1032-1061 amino acids from the C-terminal region of human ITGA8
ITGA8 (NM_003638) Human Untagged Clone
SC303358

USD 2,160.00

In Stock

ITGA8 (untagged)-Human integrin, alpha 8 (ITGA8)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ITGA8 (NM_003638) Human Over-expression Lysate
LY418532

USD 605.00

5 Days

Transient overexpression lysate of integrin, alpha 8 (ITGA8)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ITGA8 Rabbit Polyclonal Antibody
TA338225

USD 375.00

5 Days

Rabbit Polyclonal Anti-ITGA8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGA8 antibody: synthetic peptide directed towards the N terminal of human ITGA8. Synthetic peptide located within the following region: GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI
ITGA8 (NM_003638) Human Over-expression Lysate
LC418532

USD 187.00

2 Weeks

ITGA8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ITGA8 (NM_003638) Human Mass Spec Standard
PH318936

USD 2,055.00

3 Weeks

ITGA8 MS Standard C13 and N15-labeled recombinant protein (NP_003629)

Tag C-Myc/DDK
Expression Host HEK293
ITGA8 (NM_001291494) Human Tagged ORF Clone
RG239915

USD 1,140.00

2 Weeks

ITGA8 (GFP-tagged) - Human integrin, alpha 8 (ITGA8), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ITGA8 (NM_001291494) Human Untagged Clone
SC337809

USD 1,060.00

4 Weeks

ITGA8 (untagged) - Human integrin, alpha 8 (ITGA8), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ITGA8 (NM_003638) ICC Control Block
TB418936

USD 1,840.00

4 Weeks

Transient overexpression of ITGA8 (NM_003638) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ITGA8 (NM_001291494) ICC Control Block
TB439915

USD 1,750.00

4 Weeks

Transient overexpression of ITGA8 (NM_001291494) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ITGA8 Cytosection
TS418936

USD 225.00

4 Weeks

Transient overexpression of ITGA8 (NM_003638) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ITGA8 Cytosection
TS418936P5

USD 889.00

4 Weeks

Transient overexpression of ITGA8 (NM_003638) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ITGA8 ICC Control Sections
TS439915P5

USD 889.00

4 Weeks

Transient overexpression of ITGA8 (NM_001291494) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack