Products

View as table Download

HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

HSPA8 (untagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF particles, HSPA8 (Myc-DDK tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human heat shock 70kDa protein 8 (HSPA8), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

HSPA8 (GFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of HSPA8 (mGFP-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

HSPA8 (GFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE

Lenti ORF clone of Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Goat Polyclonal Antibody against HSPA8 (Isoform 1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1.

HSPA8 (untagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Mouse Monoclonal anti-Hsc70 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast
Conjugation Unconjugated

Rabbit polyclonal anti-HSPA8(HSC70) antibody, Loading control

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSPA8

Lenti ORF clone of Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal HSPA8 antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HSPA8.

Mouse monoclonal anti-HSPA8(HSC70) antibody, clone 1F2-H5, Loading control

Applications WB
Reactivities Human, Mouse, Rat. Not yet tested in other species
Conjugation Unconjugated

Hsc70 (HSPA8) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Porcine, Rat, Sheep
Immunogen Synthetic peptide surrounding amino acid 559 of human Hsc70

HSPA8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

HSPA8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Mouse Monoclonal anti-HSPA8 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal anti-Hsc70 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast
Conjugation Unconjugated

Rabbit polyclonal Hsc70 (Hsp73) Antibody

Applications IF, WB
Reactivities Hamster, Human, Rat
Conjugation Unconjugated
Immunogen Amino acids 618-637 of human hsc70

HSPA8 MS Standard C13 and N15-labeled recombinant protein (NP_006588)

Tag C-Myc/DDK
Expression Host HEK293

HSPA8 / HSC70 (active) human recombinant protein, 2x0.1 mg

Expression Host E. coli

HSPA8 / HSC70 (active) human recombinant protein, 0.1 mg

Expression Host E. coli

HSPA8 / HSC70 (active) human recombinant protein, 50 µg

Expression Host E. coli

HSPA8 / HSC70 (1-646, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

HSPA8 / HSC70 (1-646, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Carrier-free (BSA/glycerol-free) HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HSPA8 (untagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2

Vector pCMV6 series
Tag Tag Free

HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Transient overexpression of HSPA8 (NM_006597) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of HSPA8 (NM_153201) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of HSPA8 (NM_006597) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of HSPA8 (NM_006597) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of HSPA8 (NM_153201) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack