Germany
Japan
United Kingdom
China
HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
HSPA8 (untagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 1,092.00
5 Weeks
Lenti ORF particles, HSPA8 (Myc-DDK tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, HSPA8 (Myc-DDK tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Lenti ORF particles, HSPA8 (mGFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
HSPA8 (GFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, HSPA8 (mGFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, HSPA8 (Myc-DDK-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of HSPA8 (mGFP-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, HSPA8 (mGFP-tagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
HSPA8 (GFP-tagged) - Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Lenti ORF clone of Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Goat Polyclonal Antibody against HSPA8 (Isoform 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1. |
HSPA8 (untagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of heat shock 70kDa protein 8 (HSPA8), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal HSPA8 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HSPA8. |
Mouse monoclonal anti-HSPA8(HSC70) antibody, clone 1F2-H5, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat. Not yet tested in other species |
| Conjugation | Unconjugated |
Hsc70 (HSPA8) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Hamster, Human, Monkey, Mouse, Porcine, Rat, Sheep |
| Immunogen | Synthetic peptide surrounding amino acid 559 of human Hsc70 |
HSPA8 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
HSPA8 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Mouse Monoclonal anti-HSPA8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HSPA8 MS Standard C13 and N15-labeled recombinant protein (NP_006588)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
HSPA8 / HSC70 (active) human recombinant protein, 2x0.1 mg
| Expression Host | E. coli |
HSPA8 / HSC70 (active) human recombinant protein, 0.1 mg
| Expression Host | E. coli |
HSPA8 / HSC70 (active) human recombinant protein, 50 µg
| Expression Host | E. coli |
HSPA8 / HSC70 (1-646, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
HSPA8 / HSC70 (1-646, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of heat shock 70kDa protein 8 (HSPA8), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
HSPA8 (untagged)-Human heat shock 70kDa protein 8 (HSPA8), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of HSPA8 (NM_006597) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HSPA8 (NM_153201) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HSPA8 (NM_006597) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HSPA8 (NM_006597) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of HSPA8 (NM_153201) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- HSPA8
Pathways
- Endocytosis