Germany
Japan
United Kingdom
China
VTA1 (Myc-DDK-tagged)-Human Vps20-associated 1 homolog (S. cerevisiae) (VTA1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human Vps20-associated 1 homolog (S. cerevisiae) (VTA1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, VTA1 (Myc-DDK tagged) - Human Vps20-associated 1 homolog (S. cerevisiae) (VTA1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, VTA1 (mGFP-tagged) - Human Vps20-associated 1 homolog (S. cerevisiae) (VTA1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
VTA1 (GFP-tagged) - Human Vps20-associated 1 homolog (S. cerevisiae) (VTA1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human Vps20-associated 1 homolog (S. cerevisiae) (VTA1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, VTA1 (Myc-DDK tagged) - Human Vps20-associated 1 homolog (S. cerevisiae) (VTA1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human Vps20-associated 1 homolog (S. cerevisiae) (VTA1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, VTA1 (mGFP-tagged) - Human Vps20-associated 1 homolog (S. cerevisiae) (VTA1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
VTA1 (myc-DDK-tagged) - Human vesicle (multivesicular body) trafficking 1 (VTA1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
VTA1 (myc-DDK-tagged) - Human vesicle (multivesicular body) trafficking 1 (VTA1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human Vps20-associated 1 homolog (S. cerevisiae) (VTA1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-VTA1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VTA1 antibody: synthetic peptide directed towards the N terminal of human VTA1. Synthetic peptide located within the following region: KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT |
Lenti ORF clone of Human Vps20-associated 1 homolog (S. cerevisiae) (VTA1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
VTA1 (untagged)-Human Vps20-associated 1 homolog (S. cerevisiae) (VTA1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
VTA1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of Vps20-associated 1 homolog (S. cerevisiae) (VTA1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
VTA1 (1-307, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
VTA1 (1-307, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
VTA1 MS Standard C13 and N15-labeled recombinant protein (NP_057569)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
VTA1 (GFP-tagged) - Human vesicle (multivesicular body) trafficking 1 (VTA1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
VTA1 (GFP-tagged) - Human vesicle (multivesicular body) trafficking 1 (VTA1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
VTA1 (untagged) - Human vesicle (multivesicular body) trafficking 1 (VTA1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
VTA1 (untagged) - Human vesicle (multivesicular body) trafficking 1 (VTA1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of VTA1 (NM_016485) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VTA1 (NM_001286372) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VTA1 (NM_001286371) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of VTA1 (NM_016485) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of VTA1 (NM_016485) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of VTA1 (NM_001286372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of VTA1 (NM_001286371) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- VTA1
Pathways
- Endocytosis