Germany
Japan
United Kingdom
China
PAFAH1B1 (Myc-DDK-tagged)-Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, PAFAH1B1 (Myc-DDK tagged) - Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, PAFAH1B1 (mGFP-tagged) - Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa (PAFAH1B1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PAFAH1B1 (GFP-tagged) - Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, PAFAH1B1 (Myc-DDK tagged) - Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, PAFAH1B1 (mGFP-tagged) - Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
LIS1 (PAFAH1B1) (397-410) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bat, Bovine, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus, Zebrafish |
| Immunogen | Peptide from (C-term) of the protein sequence according to NP_000421 |
PAFAH1B1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PAFAH1B1 (untagged)-Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal Anti-PAFAH1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAFAH1B1 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B1. Synthetic peptide located within the following region: MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGL |
Rabbit polyclonal Anti-PAFAH1B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAFAH1B1 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B1. Synthetic peptide located within the following region: KLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVF |
Transient overexpression lysate of platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45kDa) (PAFAH1B1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PAFAH1B1 MS Standard C13 and N15-labeled recombinant protein (NP_000421)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Anti-PAFAH1B1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 61-74 amino acids of Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) |
Anti-PAFAH1B1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 61-74 amino acids of Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) |
Transient overexpression of PAFAH1B1 (NM_000430) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PAFAH1B1 (NM_000430) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PAFAH1B1 (NM_000430) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PAFAH1B1
Pathways
- Ether lipid metabolism