Germany
Japan
United Kingdom
China
PAFAH1B1 (Myc-DDK-tagged)-Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Pafah1b1 (Myc-DDK-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, beta1 subunit (cDNA clone MGC:13913 IMAGE:4017963)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, PAFAH1B1 (Myc-DDK tagged) - Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, PAFAH1B1 (mGFP-tagged) - Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa (PAFAH1B1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PAFAH1B1 (GFP-tagged) - Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Pafah1b1 (GFP-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, beta1 subunit (cDNA clone MGC:25297 IMAGE:4507474)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Pafah1b1 (Myc-DDK-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, subunit 1 (Pafah1b1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Pafah1b1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN512751 is the updated version of KN312751.
Pafah1b1 (GFP-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, beta1 subunit (cDNA clone MGC:13913 IMAGE:4017963)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pafah1b1 (Myc-DDK-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, beta1 subunit (cDNA clone MGC:13913 IMAGE:4017963)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pafah1b1 (Myc-DDK-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, beta1 subunit (cDNA clone MGC:13913 IMAGE:4017963),, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pafah1b1 (mGFP-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, beta1 subunit (cDNA clone MGC:13913 IMAGE:4017963)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pafah1b1 (GFP-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, beta1 subunit (cDNA clone MGC:13913 IMAGE:4017963),, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pafah1b1 (Myc-DDK-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, subunit 1 (Pafah1b1), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pafah1b1 (Myc-DDK-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, subunit 1 (Pafah1b1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pafah1b1 (mGFP-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, subunit 1 (Pafah1b1), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pafah1b1 (GFP-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, subunit 1 (Pafah1b1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, PAFAH1B1 (Myc-DDK tagged) - Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, PAFAH1B1 (mGFP-tagged) - Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Pafah1b1 (Myc-DDK-tagged ORF) - Rat platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa (Pafah1b1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pafah1b1 (Myc-DDK-tagged ORF) - Rat platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa (Pafah1b1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pafah1b1 (Myc-DDK-tagged ORF) - Rat platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa (Pafah1b1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pafah1b1 (mGFP-tagged ORF) - Rat platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa (Pafah1b1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pafah1b1 (GFP-tagged ORF) - Rat platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa (Pafah1b1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
LIS1 (PAFAH1B1) (397-410) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bat, Bovine, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus, Zebrafish |
| Immunogen | Peptide from (C-term) of the protein sequence according to NP_000421 |
PAFAH1B1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Pafah1b1 (untagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, subunit 1 (Pafah1b1), transcript variant 1, (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PAFAH1B1 (untagged)-Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) (PAFAH1B1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PAFAH1B1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Pafah1b1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Goat Polyclonal Antibody against PAFAH1B1
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence TGSVDQTVKVWECR, from the C Terminus of the protein sequence according to NP_000421. |
Rabbit polyclonal Anti-PAFAH1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAFAH1B1 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B1. Synthetic peptide located within the following region: MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGL |
Rabbit polyclonal Anti-PAFAH1B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAFAH1B1 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B1. Synthetic peptide located within the following region: KLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVF |
PAFAH1B1 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
PAFAH1B1 CRISPRa kit - CRISPR gene activation of human platelet activating factor acetylhydrolase 1b regulatory subunit 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Pafah1b1 CRISPRa kit - CRISPR gene activation of mouse platelet-activating factor acetylhydrolase, isoform 1b, subunit 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene PAFAH1B1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Transient overexpression lysate of platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45kDa) (PAFAH1B1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Pafah1b1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Pafah1b1
PAFAH1B1 MS Standard C13 and N15-labeled recombinant protein (NP_000421)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Pafah1b1 (untagged ORF) - Rat platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa (Pafah1b1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Pafah1b1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-PAFAH1B1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 61-74 amino acids of Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) |
Anti-PAFAH1B1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 61-74 amino acids of Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) |
Active filters
Target Symbol
- PAFAH1B1