Germany
Japan
United Kingdom
China
GALK2 (Myc-DDK-tagged)-Human galactokinase 2 (GALK2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
GALK2 (Myc-DDK-tagged)-Human galactokinase 2 (GALK2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human galactokinase 2 (GALK2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, GALK2 (Myc-DDK tagged) - Human galactokinase 2 (GALK2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, GALK2 (mGFP-tagged) - Human galactokinase 2 (GALK2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
GALK2 (GFP-tagged) - Human galactokinase 2 (GALK2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human galactokinase 2 (GALK2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GALK2 (Myc-DDK tagged) - Human galactokinase 2 (GALK2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human galactokinase 2 (GALK2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GALK2 (mGFP-tagged) - Human galactokinase 2 (GALK2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human galactokinase 2 (GALK2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GALK2 (Myc-DDK tagged) - Human galactokinase 2 (GALK2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human galactokinase 2 (GALK2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GALK2 (mGFP-tagged) - Human galactokinase 2 (GALK2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GALK2 (myc-DDK-tagged) - Human galactokinase 2 (GALK2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GALK2 (myc-DDK-tagged) - Human galactokinase 2 (GALK2), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GALK2 (GFP-tagged) - Human galactokinase 2 (GALK2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human galactokinase 2 (GALK2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of galactokinase 2 (GALK2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human galactokinase 2 (GALK2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
GALK2 (untagged)-Human galactokinase 2 (GALK2), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of galactokinase 2 (GALK2), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GALK2 (untagged)-Human galactokinase 2 (GALK2), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GALK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GALK2 antibody is: synthetic peptide directed towards the C-terminal region of Human GALK2. Synthetic peptide located within the following region: TVSMVPADKLPSFLANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLE |
GALK2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
GALK2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GALK2 MS Standard C13 and N15-labeled recombinant protein (NP_002035)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
GALK2 MS Standard C13 and N15-labeled recombinant protein (NP_001001556)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
GALK2 (GFP-tagged) - Human galactokinase 2 (GALK2), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GALK2 (GFP-tagged) - Human galactokinase 2 (GALK2), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GALK2 (untagged) - Human galactokinase 2 (GALK2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GALK2 (untagged) - Human galactokinase 2 (GALK2), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of GALK2 (NM_002044) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GALK2 (NM_001001556) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GALK2 (NM_001289030) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GALK2 (NM_001289031) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human galactokinase 2 (GALK2), transcript variant 1
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human galactokinase 2 (GALK2), transcript variant 1
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human galactokinase 2 (GALK2), transcript variant 1
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human galactokinase 2 (GALK2), transcript variant 1
| Tag | C-His |
| Expression Host | HEK293 |
Transient overexpression of GALK2 (NM_002044) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GALK2 (NM_002044) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GALK2 (NM_001001556) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GALK2 (NM_001001556) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GALK2 (NM_001289030) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GALK2 (NM_001289031) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GALK2
Pathways
- Galactose metabolism