Products

cDNA Clones (9)
Antibodies (5)
Proteins (3)
Jump to Filters
View as table Download
beta 1 Adrenergic Receptor (ADRB1) (NM_000684) Human Tagged ORF Clone Lentiviral Particle
RC217134L3V

USD 820.00

7 Weeks

Lenti ORF particles, ADRB1 (Myc-DDK tagged) - Human adrenergic, beta-1-, receptor (ADRB1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA329147

USD 310.00

In Stock

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA313441

USD 345.00

4 Weeks

Rabbit polyclonal anti-ADRB1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADRB1 .
beta 1 Adrenergic Receptor (ADRB1) Goat Polyclonal Antibody
TA303089

USD 375.00

5 Days

Goat Polyclonal Antibody against ADRB1

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide with sequence ESDEARRCYNDPK, from the internal region of the protein sequence according to NP_000675.1.
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA341637

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA321176

USD 345.00

4 Weeks

Anti-ADRB1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Beta-1 adrenergic receptor
beta 1 Adrenergic Receptor (ADRB1) ICC Control Block
TB417134

USD 1,070.00

4 Weeks

Transient overexpression of ADRB1 (NM_000684) in HEK293T cells paraffin embedded controls for ICC/IHC staining

beta 1 Adrenergic Receptor (ADRB1) Cytosection
TS417134

USD 225.00

4 Weeks

Transient overexpression of ADRB1 (NM_000684) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

beta 1 Adrenergic Receptor (ADRB1) Cytosection
TS417134P5

USD 889.00

4 Weeks

Transient overexpression of ADRB1 (NM_000684) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack