Products

cDNA Clones (11)
Antibodies (7)
Proteins (3)
Jump to Filters
View as table Download
HTR2B (NM_000867) Human Tagged ORF Clone
RC209364

USD 420.00

In Stock

HTR2B (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HTR2B (NM_000867) Human Tagged ORF Clone Lentiviral Particle
RC209364L1V

USD 820.00

3 Weeks

Lenti ORF particles, HTR2B (Myc-DDK tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
HTR2B (NM_000867) Human Tagged ORF Clone Lentiviral Particle
RC209364L2V

USD 820.00

6 Weeks

Lenti ORF particles, HTR2B (mGFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
HTR2B (NM_000867) Human Tagged ORF Clone
RG209364

USD 460.00

In Stock

HTR2B (GFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HTR2B (NM_000867) Human Tagged ORF Clone
RC209364L3

USD 620.00

3 Weeks

Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HTR2B (NM_000867) Human Tagged ORF Clone Lentiviral Particle
RC209364L3V

USD 820.00

5 Weeks

Lenti ORF particles, HTR2B (Myc-DDK tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HTR2B (NM_000867) Human Tagged ORF Clone
RC209364L4

USD 620.00

3 Weeks

Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HTR2B (NM_000867) Human Tagged ORF Clone Lentiviral Particle
RC209364L4V

USD 820.00

7 Weeks

Lenti ORF particles, HTR2B (mGFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HTR2B (NM_000867) Human Untagged Clone
SC300142

USD 760.00

In Stock

HTR2B (untagged)-Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
HTR2B (NM_000867) Human Tagged ORF Clone
RC209364L1

USD 768.00

In Stock

Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
HTR2B Rabbit Polyclonal Antibody
TA332831

USD 275.00

3 Weeks

Rabbit anti-HTR2B Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HTR2B
HTR2B Rabbit Polyclonal Antibody
TA314042

USD 345.00

4 Weeks

Rabbit polyclonal anti-5-HT-2B antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-2B.
HTR2B (NM_000867) Human Tagged ORF Clone
RC209364L2

USD 620.00

3 Weeks

Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
HTR2B Rabbit Polyclonal Antibody
TA329175

USD 375.00

5 Days

Rabbit Polyclonal anti-HTR2B antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR2B antibody: synthetic peptide directed towards the N terminal of human HTR2B. Synthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK
HTR2B Rabbit Polyclonal Antibody
TA340415

USD 425.00

5 Days

Rabbit Polyclonal Anti-HTR2B Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR1B / 5-HT2B Receptor antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human 5HT2B Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Monkey (100%); Marmoset, Bat (95%); Horse (90%); Dog, Panda (85%); Bovine, Rabbit (80%).
HTR2B Rabbit Polyclonal Antibody
TA340414

USD 425.00

5 Days

Rabbit Polyclonal Anti-HTR2B Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR1B / 5-HT2B Receptor antibody was raised against synthetic 15 amino acid peptide from 2nd extracellular domain of human 5HT2B Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Bovine, Bat (93%); Mouse, Hamster, Panda, Horse, Rabbit, Pig (80%).
HTR2B Rabbit Polyclonal Antibody
TA321221

USD 345.00

4 Weeks

Anti-HTR2B Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-58 amino acids of human 5-hydroxytryptamine receptor 2B
HTR2B Rabbit Polyclonal Antibody
TA321222

USD 345.00

4 Weeks

Anti-HTR2B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-58 amino acids of Human 5-hydroxytryptamine receptor 2B
HTR2B ICC Control Block
TB409364

USD 1,070.00

4 Weeks

Transient overexpression of HTR2B (NM_000867) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HTR2B Cytosection
TS409364

USD 225.00

4 Weeks

Transient overexpression of HTR2B (NM_000867) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HTR2B Cytosection
TS409364P5

USD 889.00

4 Weeks

Transient overexpression of HTR2B (NM_000867) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack