Germany
Japan
United Kingdom
China
HTR2B (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, HTR2B (Myc-DDK tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, HTR2B (mGFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Htr2b (Myc-DDK-tagged ORF) - Rat 5-hydroxytryptamine (serotonin) receptor 2B (Htr2b), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Htr2b (GFP-tagged) - Mouse 5-hydroxytryptamine (serotonin) receptor 2B (Htr2b), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Htr2b (Myc-DDK-tagged) - Mouse 5-hydroxytryptamine (serotonin) receptor 2B (Htr2b)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
HTR2B (GFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
HTR2B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN409364 is the updated version of KN209364.
Htr2b - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508029 is the updated version of KN308029.
Lenti ORF clone of Htr2b (Myc-DDK-tagged) - Mouse 5-hydroxytryptamine (serotonin) receptor 2B (Htr2b)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Htr2b (Myc-DDK-tagged) - Mouse 5-hydroxytryptamine (serotonin) receptor 2B (Htr2b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Htr2b (mGFP-tagged) - Mouse 5-hydroxytryptamine (serotonin) receptor 2B (Htr2b)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Htr2b (GFP-tagged) - Mouse 5-hydroxytryptamine (serotonin) receptor 2B (Htr2b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, HTR2B (Myc-DDK tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, HTR2B (mGFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Htr2b (Myc-DDK-tagged ORF) - Rat 5-hydroxytryptamine (serotonin) receptor 2B (Htr2b), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Htr2b (Myc-DDK-tagged ORF) - Rat 5-hydroxytryptamine (serotonin) receptor 2B (Htr2b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Htr2b (mGFP-tagged ORF) - Rat 5-hydroxytryptamine (serotonin) receptor 2B (Htr2b), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Htr2b (GFP-tagged ORF) - Rat 5-hydroxytryptamine (serotonin) receptor 2B (Htr2b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
HTR2B - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol (34 ug/ml) |
| Mammalian Cell Selection | Puromycin |
HTR2B - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
HTR2B (untagged)-Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit anti-HTR2B Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HTR2B |
Htr2b (untagged) - Mouse 5-hydroxytryptamine (serotonin) receptor 2B (Htr2b), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Htr2b (untagged ORF) - Rat 5-hydroxytryptamine (serotonin) receptor 2B (Htr2b), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
HTR2B (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Htr2b (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Rabbit Polyclonal anti-HTR2B antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR2B antibody: synthetic peptide directed towards the N terminal of human HTR2B. Synthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK |
Rabbit Polyclonal Anti-HTR2B Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HTR1B / 5-HT2B Receptor antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human 5HT2B Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Monkey (100%); Marmoset, Bat (95%); Horse (90%); Dog, Panda (85%); Bovine, Rabbit (80%). |
qSTAR qPCR primer pairs against Homo sapiens gene HTR2B
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Rabbit Polyclonal Anti-HTR2B Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HTR1B / 5-HT2B Receptor antibody was raised against synthetic 15 amino acid peptide from 2nd extracellular domain of human 5HT2B Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Bovine, Bat (93%); Mouse, Hamster, Panda, Horse, Rabbit, Pig (80%). |
HTR2B CRISPRa kit - CRISPR gene activation of human 5-hydroxytryptamine receptor 2B
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Htr2b CRISPRa kit - CRISPR gene activation of mouse 5-hydroxytryptamine (serotonin) receptor 2B
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Mus musculus gene Htr2b
3`UTR clone of 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Htr2b (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-HTR2B Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-58 amino acids of human 5-hydroxytryptamine receptor 2B |
HTR2B Antibody - C-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse HTR2B |
HTR2B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 233-330 of human HTR2B (NP_000858.3). |
| Modifications | Unmodified |
Transient overexpression of HTR2B (NM_000867) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Htr2b - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Htr2b - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Htr2b - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Htr2b - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- HTR2B