AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, AMT (Myc-DDK tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, AMT (mGFP-tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, AMT (Myc-DDK tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, AMT (mGFP-tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, AMT (Myc-DDK tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, AMT (mGFP-tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of AMT (mGFP-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, AMT (mGFP-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, AMT (Myc-DDK-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of AMT (mGFP-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, AMT (mGFP-tagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
AMT (GFP-tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AMT (GFP-tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AMT (GFP-tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AMT (GFP-tagged) - Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
AMT (untagged)-Human aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
AMT HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 121.00
In Stock
AMT HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 396.00
In Stock
Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 396.00
In Stock
Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Aminomethyltransferase (AMT) (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human AMT |
Rabbit Polyclonal Anti-AMT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-AMT Antibody: synthetic peptide directed towards the N terminal of human AMT. Synthetic peptide located within the following region: QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA |
Aminomethyltransferase (29-403, His-tag) human protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
Aminomethyltransferase (29-403, His-tag) human protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) AMT mouse monoclonal antibody, clone OTI5D12 (formerly 5D12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) AMT mouse monoclonal antibody, clone OTI6F4 (formerly 6F4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 121.00
2 Weeks
AMT HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 121.00
2 Weeks
AMT HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
AMT MS Standard C13 and N15-labeled recombinant protein (NP_000472)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
AMT (untagged)-Human aminomethyltransferase (AMT) nuclear gene encoding mitochondrial protein transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
AMT (untagged)-Human aminomethyltransferase (AMT) nuclear gene encoding mitochondrial protein transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
AMT (untagged)-Human aminomethyltransferase (AMT) nuclear gene encoding mitochondrial protein transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
USD 379.00
In Stock
AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |