Products

cDNA Clones (22)
Proteins (11)
Antibodies (3)
Jump to Filters
View as table Download
HNMT (NM_006895) Human Tagged ORF Clone
RC204676

USD 420.00

In Stock

HNMT (Myc-DDK-tagged)-Human histamine N-methyltransferase (HNMT), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HNMT (NM_006895) Human Tagged ORF Clone
RG204676

USD 460.00

In Stock

HNMT (GFP-tagged) - Human histamine N-methyltransferase (HNMT), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HNMT (NM_006895) Human Tagged ORF Clone
RC204676L3

USD 620.00

3 Weeks

Lenti ORF clone of Human histamine N-methyltransferase (HNMT), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HNMT (NM_006895) Human Tagged ORF Clone Lentiviral Particle
RC204676L3V

USD 820.00

6 Weeks

Lenti ORF particles, HNMT (Myc-DDK tagged) - Human histamine N-methyltransferase (HNMT), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HNMT (NM_006895) Human Tagged ORF Clone
RC204676L4

USD 620.00

3 Weeks

Lenti ORF clone of Human histamine N-methyltransferase (HNMT), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HNMT (NM_006895) Human Tagged ORF Clone Lentiviral Particle
RC204676L4V

USD 820.00

6 Weeks

Lenti ORF particles, HNMT (mGFP-tagged) - Human histamine N-methyltransferase (HNMT), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HNMT (NM_001024074) Human Tagged ORF Clone
RC211437

USD 420.00

2 Weeks

HNMT (Myc-DDK-tagged)-Human histamine N-methyltransferase (HNMT), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HNMT (NM_001024074) Human Tagged ORF Clone
RC211437L3

USD 620.00

8 Weeks

Lenti-ORF clone of HNMT (Myc-DDK-tagged)-Human histamine N-methyltransferase (HNMT), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HNMT (NM_001024074) Human Tagged ORF Clone Lentiviral Particle
RC211437L3V

USD 820.00

11 Weeks

Lenti ORF particles, HNMT (Myc-DDK-tagged)-Human histamine N-methyltransferase (HNMT), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HNMT (NM_001024074) Human Tagged ORF Clone
RC211437L4

USD 620.00

8 Weeks

Lenti-ORF clone of HNMT (mGFP-tagged)-Human histamine N-methyltransferase (HNMT), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HNMT (NM_001024074) Human Tagged ORF Clone Lentiviral Particle
RC211437L4V

USD 820.00

11 Weeks

Lenti ORF particles, HNMT (mGFP-tagged)-Human histamine N-methyltransferase (HNMT), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HNMT (NM_001024075) Human Tagged ORF Clone
RC224361

USD 420.00

2 Weeks

HNMT (Myc-DDK-tagged)-Human histamine N-methyltransferase (HNMT), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HNMT (NM_001024075) Human Tagged ORF Clone
RC224361L3

USD 620.00

8 Weeks

Lenti-ORF clone of HNMT (Myc-DDK-tagged)-Human histamine N-methyltransferase (HNMT), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HNMT (NM_001024075) Human Tagged ORF Clone Lentiviral Particle
RC224361L3V

USD 820.00

11 Weeks

Lenti ORF particles, HNMT (Myc-DDK-tagged)-Human histamine N-methyltransferase (HNMT), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HNMT (NM_001024075) Human Tagged ORF Clone
RC224361L4

USD 620.00

8 Weeks

Lenti-ORF clone of HNMT (mGFP-tagged)-Human histamine N-methyltransferase (HNMT), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HNMT (NM_001024075) Human Tagged ORF Clone Lentiviral Particle
RC224361L4V

USD 820.00

11 Weeks

Lenti ORF particles, HNMT (mGFP-tagged)-Human histamine N-methyltransferase (HNMT), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HNMT (NM_001024074) Human Tagged ORF Clone
RG211437

USD 460.00

3 Weeks

HNMT (GFP-tagged) - Human histamine N-methyltransferase (HNMT), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HNMT (NM_001024075) Human Tagged ORF Clone
RG224361

USD 460.00

3 Weeks

HNMT (GFP-tagged) - Human histamine N-methyltransferase (HNMT), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HNMT Rabbit Polyclonal Antibody
TA332537

USD 275.00

3 Weeks

Rabbit anti-HNMT Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human HNMT
HNMT (NM_006895) Human Over-expression Lysate
LY416336

USD 396.00

In Stock

Transient overexpression lysate of histamine N-methyltransferase (HNMT), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HNMT (NM_006895) Human Untagged Clone
SC321115

USD 310.00

In Stock

HNMT (untagged)-Human histamine N-methyltransferase (HNMT), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
HNMT Rabbit Polyclonal Antibody
TA324550

USD 450.00

5 Days

Rabbit polyclonal HNMT Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HNMT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human HNMT.
HNMT (NM_006895) Human Over-expression Lysate
LC416336

USD 121.00

In Stock

HNMT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HNMT (NM_006895) Human Untagged Clone
SC115807

USD 310.00

In Stock

HNMT (untagged)-Human histamine N-methyltransferase (HNMT), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
HNMT Rabbit Polyclonal Antibody
TA342675

USD 375.00

5 Days

Rabbit Polyclonal Anti-HNMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNMT antibody: synthetic peptide directed towards the N terminal of human HNMT. Synthetic peptide located within the following region: PGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEP
HNMT / HMT (1-292, His-tag) Human Protein
AR09152PU-L

USD 845.00

2 Weeks

HNMT / HMT (1-292, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
HNMT / HMT (1-292, His-tag) Human Protein
AR09152PU-N

USD 330.00

2 Weeks

HNMT / HMT (1-292, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
HNMT (NM_001024074) Human Untagged Clone
SC302228

USD 420.00

2 Weeks

HNMT (untagged)-Human histamine N-methyltransferase (HNMT), transcript variant 2

Vector pCMV6 series
Tag Tag Free
HNMT (NM_001024075) Human Untagged Clone
SC302229

USD 420.00

2 Weeks

HNMT (untagged)-Human histamine N-methyltransferase (HNMT), transcript variant 3

Vector pCMV6 series
Tag Tag Free
HNMT ICC Control Block
TB404676

USD 1,070.00

4 Weeks

Transient overexpression of HNMT (NM_006895) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HNMT ICC Control Block
TB411437

USD 1,070.00

4 Weeks

Transient overexpression of HNMT (NM_001024074) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HNMT ICC Control Block
TB424361

USD 1,070.00

4 Weeks

Transient overexpression of HNMT (NM_001024075) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HNMT Cytosection
TS404676

USD 225.00

4 Weeks

Transient overexpression of HNMT (NM_006895) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HNMT Cytosection
TS404676P5

USD 889.00

4 Weeks

Transient overexpression of HNMT (NM_006895) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

HNMT ICC Control Sections
TS411437P5

USD 889.00

4 Weeks

Transient overexpression of HNMT (NM_001024074) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

HNMT ICC Control Sections
TS424361P5

USD 889.00

4 Weeks

Transient overexpression of HNMT (NM_001024075) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack