Germany
Japan
United Kingdom
China
PLCB1 (Myc-DDK-tagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PLCB1 (Myc-DDK-tagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PLCB1 (GFP-tagged) - Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,680.00
6 Weeks
Lenti ORF particles, PLCB1 (Myc-DDK tagged) - Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,680.00
6 Weeks
Lenti ORF particles, PLCB1 (mGFP-tagged) - Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PLCB1 (Myc-DDK-tagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,630.00
6 Weeks
Lenti ORF particles, PLCB1 (Myc-DDK-tagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PLCB1 (mGFP-tagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,630.00
6 Weeks
Lenti ORF particles, PLCB1 (mGFP-tagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PLCB1 (GFP-tagged) - Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PLCB1 (untagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 396.00
In Stock
Transient overexpression lysate of phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PLCB1 (untagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PLCB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLCB1 Antibody: synthetic peptide directed towards the middle region of human PLCB1. Synthetic peptide located within the following region: EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT |
PLCB1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PLCB1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PLCB1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY405340 is the same product as LY430611.
Transient overexpression lysate of phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PLCB1 MS Standard C13 and N15-labeled recombinant protein (NP_056007)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PLCB1 MS Standard C13 and N15-labeled recombinant protein (NP_877398)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of PLCB1 (NM_015192) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLCB1 (NM_182734) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLCB1 (NM_015192) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PLCB1 (NM_015192) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PLCB1 (NM_182734) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PLCB1 (NM_182734) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PLCB1
Pathways
- Huntington's disease