Products

cDNA Clones (12)
Antibodies (11)
Proteins (3)
Jump to Filters
View as table Download
CoREST (RCOR1) (NM_015156) Human Tagged ORF Clone
RC224027

USD 420.00

In Stock

RCOR1 (Myc-DDK-tagged)-Human REST corepressor 1 (RCOR1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CoREST (RCOR1) (NM_015156) Human Tagged ORF Clone
RG224027

USD 460.00

In Stock

RCOR1 (GFP-tagged) - Human REST corepressor 1 (RCOR1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CoREST (RCOR1) (NM_015156) Human Tagged ORF Clone
RC224027L3

USD 620.00

3 Weeks

Lenti-ORF clone of RCOR1 (Myc-DDK-tagged)-Human REST corepressor 1 (RCOR1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CoREST (RCOR1) (NM_015156) Human Untagged Clone
SC107973

USD 810.00

In Stock

RCOR1 (untagged)-Human REST corepressor 1 (RCOR1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CoREST (RCOR1) Rabbit Polyclonal Antibody
TA343771

USD 410.00

5 Days

Rabbit Polyclonal Anti-RCOR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the N terminal of human RCOR1. Synthetic peptide located within the following region: MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASS
CoREST (RCOR1) (NM_015156) Human Tagged ORF Clone
RC224027L1

USD 620.00

In Stock

Lenti-ORF clone of RCOR1 (Myc-DDK-tagged)-Human REST corepressor 1 (RCOR1)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CoREST (RCOR1) Rabbit Polyclonal Antibody
TA343772

USD 475.00

5 Days

Rabbit Polyclonal Anti-RCOR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the C terminal of human RCOR1. Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS
CoREST (RCOR1) Mouse Monoclonal Antibody [Clone ID: K72/8]
73-039

USD 530.00

3 Weeks

CoREST (RCOR1) mouse monoclonal antibody, clone K72/8

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CoREST (RCOR1) Mouse Monoclonal Antibody [Clone ID: K72/8]
75-039

USD 530.00

3 Weeks

CoREST (RCOR1) mouse monoclonal antibody, clone K72/8

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CoREST (RCOR1) (NM_015156) Human Tagged ORF Clone
RC224027L2

USD 620.00

3 Weeks

Lenti-ORF clone of RCOR1 (mGFP-tagged)-Human REST corepressor 1 (RCOR1)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CoREST (RCOR1) (AK026612) Human Untagged Clone
SC103934

USD 660.00

In Stock

(untagged)-Human cDNA: FLJ22959 fis, clone KAT10162

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CoREST (RCOR1) Mouse Monoclonal Antibody [Clone ID: S72-8]
TA326451

USD 410.00

5 Days

Mouse Monoclonal Anti-Co-Rest/RCOR1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CoREST (RCOR1) Rabbit Polyclonal Antibody
TA335600

USD 375.00

5 Days

Rabbit Polyclonal Anti-RCOR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RCOR1 Antibody: synthetic peptide directed towards the middle region of human RCOR1. Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS
CoREST (RCOR1) Mouse Monoclonal Antibody [Clone ID: OTI9F6]
CF813008

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RCOR1 mouse monoclonal antibody,clone OTI9F6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CoREST (RCOR1) Mouse Monoclonal Antibody [Clone ID: OTI9F6]
TA813008

USD 379.00

In Stock

RCOR1 mouse monoclonal antibody,clone OTI9F6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CoREST (RCOR1) Mouse Monoclonal Antibody [Clone ID: OTI9F6]
TA813008S

USD 159.00

2 Days

RCOR1 mouse monoclonal antibody,clone OTI9F6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CoREST (RCOR1) (NM_015156) ICC Control Block
TB424027

USD 1,070.00

4 Weeks

Transient overexpression of RCOR1 (NM_015156) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CoREST (RCOR1) Cytosection
TS424027

USD 225.00

4 Weeks

Transient overexpression of RCOR1 (NM_015156) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CoREST (RCOR1) Cytosection
TS424027P5

USD 889.00

4 Weeks

Transient overexpression of RCOR1 (NM_015156) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack