Products

cDNA Clones (25)
Antibodies (13)
Proteins (13)
Jump to Filters
View as table Download
CD51 (ITGAV) (NM_001144999) Human Tagged ORF Clone
RC227470

USD 1,050.00

In Stock

ITGAV (Myc-DDK-tagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CD51 (ITGAV) (NM_002210) Human Tagged ORF Clone
RG218837

USD 1,210.00

In Stock

ITGAV (GFP-tagged) - Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD51 (ITGAV) (NM_002210) Human Tagged ORF Clone
RC218837

USD 1,100.00

In Stock

ITGAV (Myc-DDK-tagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CD51 (ITGAV) (NM_002210) Human Untagged Clone
SC118750

USD 1,100.00

In Stock

ITGAV (untagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CD51 (ITGAV) (NM_002210) Human Tagged ORF Clone Lentiviral Particle
RC218837L1V

USD 1,500.00

3 Weeks

Lenti ORF particles, ITGAV (Myc-DDK-tagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CD51 (ITGAV) (NM_002210) Human Tagged ORF Clone Lentiviral Particle
RC218837L2V

USD 1,500.00

3 Weeks

Lenti ORF particles, ITGAV (mGFP-tagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CD51 (ITGAV) (NM_001144999) Human Tagged ORF Clone Lentiviral Particle
RC227470L1V

USD 1,450.00

3 Weeks

Lenti ORF particles, ITGAV (Myc-DDK tagged) - Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CD51 (ITGAV) (NM_001144999) Human Tagged ORF Clone Lentiviral Particle
RC227470L2V

USD 1,450.00

6 Weeks

Lenti ORF particles, ITGAV (mGFP-tagged) - Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CD51 (ITGAV) (NM_001144999) Human Tagged ORF Clone
RG227470

USD 1,160.00

3 Weeks

ITGAV (GFP-tagged) - Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD51 (ITGAV) (NM_002210) Human Tagged ORF Clone
RC218837L4

USD 1,300.00

In Stock

Lenti-ORF clone of ITGAV (mGFP-tagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD51 (ITGAV) (NM_001145000) Human Tagged ORF Clone
RG227617

USD 1,170.00

In Stock

ITGAV (GFP-tagged) - Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD51 (ITGAV) (NM_002210) Human Tagged ORF Clone
RC218837L3

USD 1,300.00

In Stock

Lenti-ORF clone of ITGAV (Myc-DDK-tagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD51 (ITGAV) (NM_002210) Human Tagged ORF Clone Lentiviral Particle
RC218837L3V

USD 1,500.00

3 Weeks

Lenti ORF particles, ITGAV (Myc-DDK-tagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD51 (ITGAV) (NM_002210) Human Tagged ORF Clone Lentiviral Particle
RC218837L4V

USD 1,500.00

3 Weeks

Lenti ORF particles, ITGAV (mGFP-tagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD51 (ITGAV) (NM_001144999) Human Tagged ORF Clone Lentiviral Particle
RC227470L3V

USD 1,450.00

3 Weeks

Lenti ORF particles, ITGAV (Myc-DDK tagged) - Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD51 (ITGAV) (NM_001144999) Human Tagged ORF Clone Lentiviral Particle
RC227470L4V

USD 1,450.00

3 Weeks

Lenti ORF particles, ITGAV (mGFP-tagged) - Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD51 (ITGAV) (NM_001145000) Human Tagged ORF Clone
RC227617

USD 1,060.00

3 Weeks

ITGAV (Myc-DDK-tagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CD51 (ITGAV) (NM_001145000) Human Tagged ORF Clone
RC227617L3

USD 1,260.00

3 Weeks

Lenti-ORF clone of ITGAV (Myc-DDK-tagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD51 (ITGAV) (NM_001145000) Human Tagged ORF Clone Lentiviral Particle
RC227617L3V

USD 1,460.00

6 Weeks

Lenti ORF particles, ITGAV (Myc-DDK-tagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD51 (ITGAV) (NM_001145000) Human Tagged ORF Clone
RC227617L4

USD 1,260.00

3 Weeks

Lenti-ORF clone of ITGAV (mGFP-tagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD51 (ITGAV) (NM_001145000) Human Tagged ORF Clone Lentiviral Particle
RC227617L4V

USD 1,460.00

6 Weeks

Lenti ORF particles, ITGAV (mGFP-tagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD51 (ITGAV) Rabbit Monoclonal Antibody [Clone ID: EPR5583]
TA310958

USD 516.00

In Stock

Rabbit Monoclonal antibody against CD51 / Integrin alpha-V (ITGAV)

Applications Assay, FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CD51 (ITGAV) (NM_001144999) Human Over-expression Lysate
LY428633

USD 605.00

In Stock

Transient overexpression lysate of integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CD51 (ITGAV) (NM_002210) Human Tagged ORF Clone
RC218837L2

USD 1,300.00

In Stock

Lenti-ORF clone of ITGAV (mGFP-tagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA327266

USD 275.00

3 Weeks

ITGAV Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human ITGAV
CD51 (ITGAV) (NM_002210) Human Over-expression Lysate
LY419450

USD 605.00

In Stock

Transient overexpression lysate of integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA347895

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Integrin aV Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Integrin aV Antibody: A synthesized peptide derived from human Integrin aV
CD51 (ITGAV) (C-term) Rabbit Polyclonal Antibody
AP31171PU-N

USD 440.00

2 Weeks

CD51 (ITGAV) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen ITGAV antibody was raised against synthetic peptide
CD51 (ITGAV) (NM_001144999) Human Tagged ORF Clone
RC227470L2

USD 1,250.00

3 Weeks

Lenti ORF clone of Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA314095

USD 345.00

In Stock

Rabbit polyclonal ITGAV (heavy chain, Cleaved-Lys889) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ITGAV.
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA590697

USD 409.00

In Stock

Rabbit Polyclonal Integrin alpha V Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
CD51 (ITGAV) (NM_002210) Human Over-expression Lysate
LC419450

USD 187.00

In Stock

ITGAV HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CD51 (ITGAV) (NM_001144999) Human Over-expression Lysate
LC428633

USD 187.00

In Stock

ITGAV HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CD51 (ITGAV) Mouse Monoclonal Antibody [Clone ID: 23C6]
TA320388

USD 185.00

5 Days

Mouse Anti-Human CD51/CD61 (Integrin alpha v beta 3) Purified (100 ug)

Applications FC
Reactivities Human
Conjugation Unconjugated
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA338302

USD 375.00

5 Days

Rabbit Polyclonal Anti-ITGAV Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGAV antibody is: synthetic peptide directed towards the C-terminal region of Human ITGAV. Synthetic peptide located within the following region: PVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENG
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA323922

USD 345.00

4 Weeks

Anti-ITGAV Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1021-1034 amino acids of human integrin, alpha V
CD51 (ITGAV) Rat Monoclonal Antibody [Clone ID: AvB6 53a.2]
TA352872L

USD 1,140.00

2 Weeks

Rat monoclonal Anti-Integrin aVb6 Clone AvB6 53a.2

Reactivities Human
Conjugation Unconjugated
CD51 (ITGAV) Rat Monoclonal Antibody [Clone ID: Avβ6 62ow.17]
TA352873L

USD 1,140.00

2 Weeks

Rat monoclonal Anti-Integrin aVβ6 Clone Avβ6 62ow.17

Reactivities Human
Conjugation Unconjugated
CD51 (ITGAV) Mouse Monoclonal Antibody [Clone ID: P2W7]
TA353262L

USD 1,140.00

2 Weeks

Mouse monoclonal Anti-Integrin aV Clone P2W7

Reactivities Human
Conjugation Unconjugated
CD51 (ITGAV) Mouse Monoclonal Antibody [Clone ID: HCD51]
TA354806

USD 355.00

5 Days

Mouse anti CD51 Monoclonal Antibody

Applications FC
Reactivities Human
Conjugation Unconjugated
CD51 (ITGAV) (NM_001144999) Human Untagged Clone
SC326311

USD 2,030.00

3 Weeks

ITGAV (untagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CD51 (ITGAV) (NM_001145000) Human Untagged Clone
SC326313

USD 1,100.00

6 Weeks

ITGAV (untagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 3

Vector pCMV6 series
Tag Tag Free
CD51 (ITGAV) ICC Control Block
TB418837

USD 1,750.00

4 Weeks

Transient overexpression of ITGAV (NM_002210) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CD51 (ITGAV) ICC Control Block
TB427470

USD 1,700.00

4 Weeks

Transient overexpression of ITGAV (NM_001144999) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CD51 (ITGAV) ICC Control Block
TB427617

USD 1,710.00

4 Weeks

Transient overexpression of ITGAV (NM_001145000) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CD51 (ITGAV) (NM_001144999) Human Recombinant Protein
TP762381

USD 205.00

2 Weeks

Purified recombinant protein of Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 2, Arg17-Leu248, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
CD51 (ITGAV) Cytosection
TS418837

USD 225.00

4 Weeks

Transient overexpression of ITGAV (NM_002210) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CD51 (ITGAV) Cytosection
TS418837P5

USD 889.00

4 Weeks

Transient overexpression of ITGAV (NM_002210) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CD51 (ITGAV) Cytosection
TS427470

USD 225.00

4 Weeks

Transient overexpression of ITGAV (NM_001144999) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CD51 (ITGAV) Cytosection
TS427470P5

USD 889.00

4 Weeks

Transient overexpression of ITGAV (NM_001144999) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack