Products

View as table Download

Recombinant protein of human hexokinase 2 (HK2)

Tag C-Myc/DDK
Expression Host HEK293T

HK2 (GFP-tagged) - Human hexokinase 2 (HK2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HK2 (untagged)-Human hexokinase 2 (HK2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal HK2 (Hexokinase II) Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 453-483 amino acids from the Central region of human HK2 (Hexokinase II).

Rabbit anti-HK2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HK2

Hexokinase-2 (1-917, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

Hexokinase-2 (1-917, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Lenti ORF clone of Human hexokinase 2 (HK2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

HK2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II).

Rabbit Polyclonal Anti-HK2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the N terminal of human HK2. Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG

Rabbit Polyclonal Anti-HK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the middle region of human HK2. Synthetic peptide located within the following region: QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLR

Carrier-free (BSA/glycerol-free) HK2 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HK2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HK2 MS Standard C13 and N15-labeled recombinant protein (NP_000180)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-HK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HK2

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5), Biotinylated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Biotin

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation HRP

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Transient overexpression of HK2 (NM_000189) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of HK2 (NM_000189) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of HK2 (NM_000189) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack