IL9 (Myc-DDK-tagged)-Human interleukin 9 (IL9)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IL9 (Myc-DDK-tagged)-Human interleukin 9 (IL9)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IL9 (GFP-tagged) - Human interleukin 9 (IL9)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human interleukin 9 (IL9), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL9 (Myc-DDK tagged) - Human interleukin 9 (IL9), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interleukin 9 (IL9), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL9 (mGFP-tagged) - Human interleukin 9 (IL9), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
IL9 (untagged)-Human interleukin 9 (IL9)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Purified recombinant protein of Human interleukin 9 (IL9).
Tag | Tag Free |
Expression Host | E. coli |
Purified recombinant protein of Human interleukin 9 (IL9)
Tag | Tag Free |
Expression Host | Sf9 |
Transient overexpression lysate of interleukin 9 (IL9)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
IL9 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%), E.coli derived 14.0 kDa recombinant Human IL-9 |
Rabbit Polyclonal IL-9 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IL-9 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human IL-9. |
IL9 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%), E.coli derived 14.0 kDa recombinant Human IL-9 |
Anti-Human IL-9 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-9 |
IL9 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
IL9 rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) recombinant hIL-9 (human IL-9). |
IL9 rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) recombinant hIL-9 (human IL-9). |
Rabbit polyclonal anti-IL-9 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein. |
Rabbit polyclonal IL-9 antibody Peroxidase Conjugated
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein. |
Biotinylated Anti-Human IL-9 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-9 |
Rabbit Polyclonal Anti-IL9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL9 Antibody: synthetic peptide directed towards the middle region of human IL9. Synthetic peptide located within the following region: SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT |
Interleukin-9 / IL9 (1-144, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Interleukin-9 / IL9 (1-144, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Transient overexpression of IL9 (NM_000590) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of IL9 (NM_000590) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of IL9 (NM_000590) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack