Products

cDNA Clones (35)
Proteins (23)
Antibodies (3)
Jump to Filters
View as table Download
NCF2 (NM_000433) Human Tagged ORF Clone
RC200704

USD 420.00

In Stock

NCF2 (Myc-DDK-tagged)-Human neutrophil cytosolic factor 2 (NCF2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NCF2 (NM_001127651) Human Tagged ORF Clone
RC225899

USD 420.00

In Stock

NCF2 (Myc-DDK-tagged)-Human neutrophil cytosolic factor 2 (NCF2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NCF2 (NM_001190789) Human Tagged ORF Clone
RC231239

USD 420.00

In Stock

NCF2 (Myc-DDK-tagged)-Human neutrophil cytosolic factor 2 (NCF2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NCF2 (NM_001190794) Human Tagged ORF Clone
RC231265

USD 450.00

In Stock

NCF2 (Myc-DDK-tagged)-Human neutrophil cytosolic factor 2 (NCF2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NCF2 (NM_000433) Human Tagged ORF Clone Lentiviral Particle
RC200704L1V

USD 820.00

3 Weeks

Lenti ORF particles, NCF2 (Myc-DDK tagged) - Human neutrophil cytosolic factor 2 (NCF2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
NCF2 (NM_000433) Human Tagged ORF Clone Lentiviral Particle
RC200704L2V

USD 820.00

6 Weeks

Lenti ORF particles, NCF2 (mGFP-tagged) - Human neutrophil cytosolic factor 2 (NCF2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
NCF2 (NM_001127651) Human Tagged ORF Clone Lentiviral Particle
RC225899L1V

USD 820.00

3 Weeks

Lenti ORF particles, NCF2 (Myc-DDK tagged) - Human neutrophil cytosolic factor 2 (NCF2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
NCF2 (NM_001127651) Human Tagged ORF Clone Lentiviral Particle
RC225899L2V

USD 820.00

6 Weeks

Lenti ORF particles, NCF2 (mGFP-tagged) - Human neutrophil cytosolic factor 2 (NCF2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
NCF2 (NM_000433) Human Tagged ORF Clone
RG200704

USD 460.00

In Stock

NCF2 (GFP-tagged) - Human neutrophil cytosolic factor 2 (NCF2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NCF2 (NM_000433) Human Tagged ORF Clone
RC200704L3

USD 620.00

3 Weeks

Lenti ORF clone of Human neutrophil cytosolic factor 2 (NCF2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_000433) Human Tagged ORF Clone Lentiviral Particle
RC200704L3V

USD 820.00

5 Weeks

Lenti ORF particles, NCF2 (Myc-DDK tagged) - Human neutrophil cytosolic factor 2 (NCF2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_000433) Human Tagged ORF Clone Lentiviral Particle
RC200704L4V

USD 820.00

3 Weeks

Lenti ORF particles, NCF2 (mGFP-tagged) - Human neutrophil cytosolic factor 2 (NCF2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_001127651) Human Tagged ORF Clone
RC225899L3

USD 620.00

3 Weeks

Lenti ORF clone of Human neutrophil cytosolic factor 2 (NCF2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_001127651) Human Tagged ORF Clone Lentiviral Particle
RC225899L3V

USD 820.00

6 Weeks

Lenti ORF particles, NCF2 (Myc-DDK tagged) - Human neutrophil cytosolic factor 2 (NCF2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_001127651) Human Tagged ORF Clone
RC225899L4

USD 620.00

3 Weeks

Lenti ORF clone of Human neutrophil cytosolic factor 2 (NCF2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_001127651) Human Tagged ORF Clone Lentiviral Particle
RC225899L4V

USD 820.00

6 Weeks

Lenti ORF particles, NCF2 (mGFP-tagged) - Human neutrophil cytosolic factor 2 (NCF2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_001190789) Human Tagged ORF Clone
RC231239L3

USD 620.00

3 Weeks

Lenti-ORF clone of NCF2 (Myc-DDK-tagged)-Human neutrophil cytosolic factor 2 (NCF2), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_001190789) Human Tagged ORF Clone Lentiviral Particle
RC231239L3V

USD 820.00

6 Weeks

Lenti ORF particles, NCF2 (Myc-DDK-tagged)-Human neutrophil cytosolic factor 2 (NCF2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_001190789) Human Tagged ORF Clone
RC231239L4

USD 620.00

3 Weeks

Lenti-ORF clone of NCF2 (mGFP-tagged)-Human neutrophil cytosolic factor 2 (NCF2), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_001190789) Human Tagged ORF Clone Lentiviral Particle
RC231239L4V

USD 820.00

6 Weeks

Lenti ORF particles, NCF2 (mGFP-tagged)-Human neutrophil cytosolic factor 2 (NCF2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_001190794) Human Tagged ORF Clone
RC231265L3

USD 650.00

3 Weeks

Lenti-ORF clone of NCF2 (Myc-DDK-tagged)-Human neutrophil cytosolic factor 2 (NCF2), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_001190794) Human Tagged ORF Clone Lentiviral Particle
RC231265L3V

USD 850.00

6 Weeks

Lenti ORF particles, NCF2 (Myc-DDK-tagged)-Human neutrophil cytosolic factor 2 (NCF2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_001190794) Human Tagged ORF Clone
RC231265L4

USD 650.00

3 Weeks

Lenti-ORF clone of NCF2 (mGFP-tagged)-Human neutrophil cytosolic factor 2 (NCF2), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_001190794) Human Tagged ORF Clone Lentiviral Particle
RC231265L4V

USD 850.00

6 Weeks

Lenti ORF particles, NCF2 (mGFP-tagged)-Human neutrophil cytosolic factor 2 (NCF2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_001127651) Human Tagged ORF Clone
RG225899

USD 460.00

3 Weeks

NCF2 (GFP-tagged) - Human neutrophil cytosolic factor 2 (NCF2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NCF2 (NM_001190789) Human Tagged ORF Clone
RG231239

USD 460.00

3 Weeks

NCF2 (GFP-tagged) - Human neutrophil cytosolic factor 2 (NCF2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NCF2 (NM_001190794) Human Tagged ORF Clone
RG231265

USD 500.00

3 Weeks

NCF2 (GFP-tagged) - Human neutrophil cytosolic factor 2 (NCF2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NCF2 Rabbit Polyclonal Antibody
TA326975

USD 275.00

2 Weeks

Rabbit anti-NCF2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human NCF2
NCF2 (NM_000433) Human Tagged ORF Clone
RC200704L1

USD 768.00

In Stock

Lenti ORF clone of Human neutrophil cytosolic factor 2 (NCF2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
NCF2 (NM_000433) Human Tagged ORF Clone
RC200704L4

USD 768.00

In Stock

Lenti ORF clone of Human neutrophil cytosolic factor 2 (NCF2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NCF2 (NM_000433) Human Untagged Clone
SC320681

USD 310.00

In Stock

NCF2 (untagged)-Human neutrophil cytosolic factor 2 (NCF2), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
NCF2 (NM_000433) Human Untagged Clone
SC119885

USD 310.00

In Stock

NCF2 (untagged)-Human neutrophil cytosolic factor 2 (NCF2), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
NCF2 (NM_000433) Human Tagged ORF Clone
RC200704L2

USD 620.00

3 Weeks

Lenti ORF clone of Human neutrophil cytosolic factor 2 (NCF2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NCF2 (NM_001127651) Human Tagged ORF Clone
RC225899L1

USD 620.00

In Stock

Lenti ORF clone of Human neutrophil cytosolic factor 2 (NCF2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
NCF2 (NM_001127651) Human Tagged ORF Clone
RC225899L2

USD 620.00

3 Weeks

Lenti ORF clone of Human neutrophil cytosolic factor 2 (NCF2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NCF2 (NM_000433) Human Over-expression Lysate
LC400154

USD 121.00

In Stock

NCF2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
NCF2 (NM_001190789) Human Over-expression Lysate
LC434238

USD 121.00

In Stock

NCF2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NCF2 (NM_001190794) Human Over-expression Lysate
LC434264

USD 121.00

In Stock

NCF2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NCF2 (NM_001190789) Human Over-expression Lysate
LY434238

USD 396.00

In Stock

Transient overexpression lysate of neutrophil cytosolic factor 2 (NCF2), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NCF2 (NM_001190794) Human Over-expression Lysate
LY434264

USD 396.00

In Stock

Transient overexpression lysate of neutrophil cytosolic factor 2 (NCF2), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NCF2 Rabbit Polyclonal Antibody
TA338377

USD 375.00

5 Days

Rabbit Polyclonal Anti-NCF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCF2 antibody is: synthetic peptide directed towards the C-terminal region of Human NCF2. Synthetic peptide located within the following region: TVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEF
NCF2 (NM_001127651) Human Over-expression Lysate
LC426836

USD 121.00

2 Weeks

NCF2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NCF2 (NM_000433) Human Over-expression Lysate
LY400154

USD 396.00

5 Days

Transient overexpression lysate of neutrophil cytosolic factor 2 (NCF2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NCF2 (NM_001127651) Human Over-expression Lysate
LY426836

USD 396.00

5 Days

Transient overexpression lysate of neutrophil cytosolic factor 2 (NCF2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NCF2 (NM_000433) Human Mass Spec Standard
PH300704

USD 2,055.00

3 Weeks

NCF2 MS Standard C13 and N15-labeled recombinant protein (NP_000424)

Tag C-Myc/DDK
Expression Host HEK293
NCF2 (NM_001127651) Human Mass Spec Standard
PH325899

USD 2,055.00

3 Weeks

NCF2 MS Standard C13 and N15-labeled recombinant protein (NP_001121123)

Tag C-Myc/DDK
Expression Host HEK293
NCF2 (NM_001127651) Human Untagged Clone
SC323119

USD 760.00

3 Weeks

NCF2 (untagged)-Human neutrophil cytosolic factor 2 (NCF2), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
NCF2 Rabbit Polyclonal Antibody
TA350235

USD 345.00

In Stock

Rabbit Polyclonal Anti-NCF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NCF2
NCF2 ICC Control Block
TB400704

USD 1,070.00

4 Weeks

Transient overexpression of NCF2 (NM_000433) in HEK293T cells paraffin embedded controls for ICC/IHC staining