PLCB1 (Myc-DDK-tagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLCB1 (Myc-DDK-tagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PLCB1 (Myc-DDK-tagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLCB1 (GFP-tagged) - Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,680.00
6 Weeks
Lenti ORF particles, PLCB1 (Myc-DDK tagged) - Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,680.00
6 Weeks
Lenti ORF particles, PLCB1 (mGFP-tagged) - Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PLCB1 (Myc-DDK-tagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,630.00
6 Weeks
Lenti ORF particles, PLCB1 (Myc-DDK-tagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PLCB1 (mGFP-tagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,630.00
6 Weeks
Lenti ORF particles, PLCB1 (mGFP-tagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PLCB1 (GFP-tagged) - Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PLCB1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PLCB1 |
PLCB1 (untagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 396.00
In Stock
Transient overexpression lysate of phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PLCB1 (untagged)-Human phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Phospholipase C beta 1 (PLCB1) (C-term) rabbit polyclonal antibody, Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1155~1184 amino acids from the C-terminal region of human PLCB1 |
Rabbit Polyclonal Anti-PLCB1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PLCB1 Antibody: synthetic peptide directed towards the middle region of human PLCB1. Synthetic peptide located within the following region: EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT |
PLCB1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PLCB1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PLCB1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of phospholipase C, beta 1 (phosphoinositide-specific) (PLCB1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PLCB1 MS Standard C13 and N15-labeled recombinant protein (NP_056007)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
PLCB1 MS Standard C13 and N15-labeled recombinant protein (NP_877398)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of PLCB1 (NM_015192) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLCB1 (NM_182734) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLCB1 (NM_015192) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PLCB1 (NM_015192) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PLCB1 (NM_182734) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PLCB1 (NM_182734) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack